(data stored in ACNUC7421 zone)

EMBL: CP000075.PE477

CP000075.PE477       Location/Qualifiers
FT   CDS             complement(515721..516407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0477"
FT                   /product="Protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35547"
FT                   /db_xref="GOA:Q4ZZ75"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ75"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35547.1"
FT                   /translation="MSTIAANISTLEQRIRDAALAAERDPASVGLLAVSKTKPASDLRE
FT                   AYNAGLRDFGENYLQEALGKQLELSDLPLCWHFIGPIQSNKTRAIAENFDWVHSVDRLK
FT                   IAQRLSEQRPEALEPLNICIQVNVSGEASKSGCTPQDLPALAATIIALPRLRLRGLMAI
FT                   PEPTDDPAAQDASFAAVRALQEQLNLALDTLSMGMSHDLEAAIAQGATWVRIGTALFGA
FT                   RDYGQP"
     MSTIAANIST LEQRIRDAAL AAERDPASVG LLAVSKTKPA SDLREAYNAG LRDFGENYLQ        60
     EALGKQLELS DLPLCWHFIG PIQSNKTRAI AENFDWVHSV DRLKIAQRLS EQRPEALEPL       120
     NICIQVNVSG EASKSGCTPQ DLPALAATII ALPRLRLRGL MAIPEPTDDP AAQDASFAAV       180
     RALQEQLNLA LDTLSMGMSH DLEAAIAQGA TWVRIGTALF GARDYGQP                    228
//

If you have problems or comments...

PBIL Back to PBIL home page