(data stored in ACNUC7421 zone)

EMBL: CP000075.PE484

CP000075.PE484       Location/Qualifiers
FT   CDS             complement(522103..522543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0484"
FT                   /product="Conserved hypothetical protein 250"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35554"
FT                   /db_xref="GOA:Q4ZZ68"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ68"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35554.1"
FT                   /translation="MAALRLLLGIDYGTKQIGVAVGQAITGQARELCTLKAQNGVPDWD
FT                   KVQALINEWKPDAIVVGLPLNMDGTPSDMSARAEKFSRKLNGRFGVTVYTHDERLTTFE
FT                   AKGERMARGGQKGSYRDNPVDAIAAALLLQGWLDEHPELLNV"
     MAALRLLLGI DYGTKQIGVA VGQAITGQAR ELCTLKAQNG VPDWDKVQAL INEWKPDAIV        60
     VGLPLNMDGT PSDMSARAEK FSRKLNGRFG VTVYTHDERL TTFEAKGERM ARGGQKGSYR       120
     DNPVDAIAAA LLLQGWLDEH PELLNV                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page