(data stored in ACNUC7421 zone)

EMBL: CP000075.PE485

CP000075.PE485       Location/Qualifiers
FT   CDS             complement(522543..523115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0485"
FT                   /product="Protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35555"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4ZZ67"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35555.1"
FT                   /translation="MKKVSPSYLKHHFLIAMPHMHDENFAQTLTYIVEHNANGAMGLVI
FT                   NRPQSLTLADVLEQLRPELPAPRHCQDIVIHTGGPVQTDRGFVLHPSGQTFQATVNLPG
FT                   GISLSTSQDVLFSIADGYGPDQNVITLGYAGWDAGQLDAEMADNAWLTCSFDPAILFDV
FT                   DSDQRLEAAARRLGINLNLISTQAGHA"
     MKKVSPSYLK HHFLIAMPHM HDENFAQTLT YIVEHNANGA MGLVINRPQS LTLADVLEQL        60
     RPELPAPRHC QDIVIHTGGP VQTDRGFVLH PSGQTFQATV NLPGGISLST SQDVLFSIAD       120
     GYGPDQNVIT LGYAGWDAGQ LDAEMADNAW LTCSFDPAIL FDVDSDQRLE AAARRLGINL       180
     NLISTQAGHA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page