(data stored in ACNUC7421 zone)

EMBL: CP000075.PE492

CP000075.PE492       Location/Qualifiers
FT   CDS             528991..534969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0492"
FT                   /product="Response regulator receiver:CheW-like
FT                   protein:ATP-binding region, ATPase-like:Hpt"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35562"
FT                   /db_xref="GOA:Q4ZZ60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ60"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35562.1"
FT                   /translation="MADRHDYVALEWLKGEIAETLRQARQALDGFIEDPANAAAMAECL
FT                   NLVHQVHGSLQMIEFYGAALLAEEIEQLALAVQQNRVSHPIESEQLLIQAMSQLPVYLE
FT                   RIHSARRDLPLVVLPLLNDLRSARGESLLSETSLFAPQLVVVPALDEQELARRNTPELP
FT                   NLLRKLRQTLQAALAGLMREQGVQTQLGYMAKVFARLEQLCEDAPLGALWRIASALVET
FT                   MLNGNFTNSPALRSLLKDADKELKRLAEQGVTGINQPAPEELLKSLLFYIAKSDSLAPK
FT                   MLDLKDQYALADALPGNDVVNEERARMAGPDRDAMRSVIVALCEGLVRVKERLDVFVRG
FT                   DRQHVSELNALLPPLRQIADTLAVLGFGQPRKVIIDQLSVVLGLAQGQREPSDAALMDV
FT                   AGALLYVESTLAGMAGSHEQVSREESRLPTTDLTQIHQLVIREARTVLQQAKDVILDYI
FT                   DGAWDRQRLDPLCALIVQVRGALAMIPLARAASLLAACNEYIQEHLLVDETRPTWVQLD
FT                   CLADTITGIEYYLERMLEDHQAPGDQVLDMAQQSLARLGYTPAADTLDVPLLEEVITQD
FT                   ELLELDDRKALVSPTQTIAQVLASPVSAVNPPARNVPASLLPPSAGEEAVDDELRDVFL
FT                   EEADEVLDALREYLPRWFTSLGSDGHWDSTALTEVRRAFHTLKGSGRMVRALILSELAW
FT                   AVENLLNRVLEGDVLPGLEVQQLMTEVQALLPSVIRDFAEGAQCQRDDVDLLAARAHAL
FT                   ANGLEPPMLPAADDHVPGQPVADEPLDPQLLEIFRQEALGHLNTLGRFLDNAEQSASPA
FT                   ISDAVLRALHTLKGSAHMAGVLPIAELASPLDQLVREYKANLIDIGSPELALLRSAEPL
FT                   LHKGLEQLDSTPLADIPGAAPLIEAALAMLNDRLTVVLRESDSGLRIKRNPTLLAGFLA
FT                   EGMDIVLDAENLLQRWRQHPGERQELSALLDELTTLGHGAHLADLPQVDELCEALLDLY
FT                   GAVEESSLAVSERFFDVAENAHEALINMLDQVAAGQDVEPRPECVRALNQLLDQALDPS
FT                   ATGLVKSDGHRTLSVTELNAATAQLASEAGHTEVAGPDDEIVEIFLEEAVDILDSAGQA
FT                   LQRWLADPENPAPLASLQRDLHTLKGGARMAEVAEVGDLAHELENLYEGLIDRRFNHSP
FT                   TLAALLNESHDHLAILLEQLYRQEALSDPSALIEALRSCRTLESAGPEVQASPAAHEDL
FT                   PEHDAELREVFLEEGFDIMESSGAALARWQADPHNMLEVENLLRDLHTLKGGARMVEIA
FT                   PIGDLAHELETLYEGLSAGSLQPAPLMIGLLQSGQDVLADMLDAVRNEKPLPDASLLIE
FT                   SIRRLATDEPSGAQLAAQDPEVHPESVVAVAPVAEGEVERSGPEMVKVPAEQLEDLVNL
FT                   AGETSIFRGRIEQQIIDSQIALVEMETTIERMRDQLRRLDMETQGRILSREQVQTERLG
FT                   YEEFDPLEMDRHSQLQQLSRALFESASDLMDLKETLGARARDAETLLSQQARVNTQLQE
FT                   GLMRTRMVPFERLVPRLRRVVRQVASELHKKVHFEVGNADGEMDRNVLERMVAPLEHML
FT                   RNAVDHGLESTEKRIAAGKPEQGHISLELMYEGGDMVIELSDDGSGVDLAAVRRKAIKR
FT                   GMIHPDADLSDHEVLPFILQAGFSTSEIITQISGRGVGMDVVHAEVKQLGGSMVIDSVP
FT                   GKGTRFRIRLPISVSVNRALMVTCGEEQYAVPLNTVDGIVRVMANELDGYYQTSPPRYQ
FT                   YGGRSYELRYLGELLGSSPPRLAGQLQPLPVLLVHLQDQWVAVQVDALAGSREIVVKSL
FT                   GPQFSRVQGISGATILGDGQVVLILDLMAQIRNLQGLPFRGLMAPAYHEVEHARPLLVM
FT                   VVDDSVTVRKVTSRLLERHGMHVLTAKDGVDAMTLLQEHTPDIMLLDIEMPRMDGFEVA
FT                   SQIRQDEQLKDLPIIMITSRSGQKHRDRAMAVGVNEYLSKPYQETVLLESIAYWSQAHV
FT                   "
     MADRHDYVAL EWLKGEIAET LRQARQALDG FIEDPANAAA MAECLNLVHQ VHGSLQMIEF        60
     YGAALLAEEI EQLALAVQQN RVSHPIESEQ LLIQAMSQLP VYLERIHSAR RDLPLVVLPL       120
     LNDLRSARGE SLLSETSLFA PQLVVVPALD EQELARRNTP ELPNLLRKLR QTLQAALAGL       180
     MREQGVQTQL GYMAKVFARL EQLCEDAPLG ALWRIASALV ETMLNGNFTN SPALRSLLKD       240
     ADKELKRLAE QGVTGINQPA PEELLKSLLF YIAKSDSLAP KMLDLKDQYA LADALPGNDV       300
     VNEERARMAG PDRDAMRSVI VALCEGLVRV KERLDVFVRG DRQHVSELNA LLPPLRQIAD       360
     TLAVLGFGQP RKVIIDQLSV VLGLAQGQRE PSDAALMDVA GALLYVESTL AGMAGSHEQV       420
     SREESRLPTT DLTQIHQLVI REARTVLQQA KDVILDYIDG AWDRQRLDPL CALIVQVRGA       480
     LAMIPLARAA SLLAACNEYI QEHLLVDETR PTWVQLDCLA DTITGIEYYL ERMLEDHQAP       540
     GDQVLDMAQQ SLARLGYTPA ADTLDVPLLE EVITQDELLE LDDRKALVSP TQTIAQVLAS       600
     PVSAVNPPAR NVPASLLPPS AGEEAVDDEL RDVFLEEADE VLDALREYLP RWFTSLGSDG       660
     HWDSTALTEV RRAFHTLKGS GRMVRALILS ELAWAVENLL NRVLEGDVLP GLEVQQLMTE       720
     VQALLPSVIR DFAEGAQCQR DDVDLLAARA HALANGLEPP MLPAADDHVP GQPVADEPLD       780
     PQLLEIFRQE ALGHLNTLGR FLDNAEQSAS PAISDAVLRA LHTLKGSAHM AGVLPIAELA       840
     SPLDQLVREY KANLIDIGSP ELALLRSAEP LLHKGLEQLD STPLADIPGA APLIEAALAM       900
     LNDRLTVVLR ESDSGLRIKR NPTLLAGFLA EGMDIVLDAE NLLQRWRQHP GERQELSALL       960
     DELTTLGHGA HLADLPQVDE LCEALLDLYG AVEESSLAVS ERFFDVAENA HEALINMLDQ      1020
     VAAGQDVEPR PECVRALNQL LDQALDPSAT GLVKSDGHRT LSVTELNAAT AQLASEAGHT      1080
     EVAGPDDEIV EIFLEEAVDI LDSAGQALQR WLADPENPAP LASLQRDLHT LKGGARMAEV      1140
     AEVGDLAHEL ENLYEGLIDR RFNHSPTLAA LLNESHDHLA ILLEQLYRQE ALSDPSALIE      1200
     ALRSCRTLES AGPEVQASPA AHEDLPEHDA ELREVFLEEG FDIMESSGAA LARWQADPHN      1260
     MLEVENLLRD LHTLKGGARM VEIAPIGDLA HELETLYEGL SAGSLQPAPL MIGLLQSGQD      1320
     VLADMLDAVR NEKPLPDASL LIESIRRLAT DEPSGAQLAA QDPEVHPESV VAVAPVAEGE      1380
     VERSGPEMVK VPAEQLEDLV NLAGETSIFR GRIEQQIIDS QIALVEMETT IERMRDQLRR      1440
     LDMETQGRIL SREQVQTERL GYEEFDPLEM DRHSQLQQLS RALFESASDL MDLKETLGAR      1500
     ARDAETLLSQ QARVNTQLQE GLMRTRMVPF ERLVPRLRRV VRQVASELHK KVHFEVGNAD      1560
     GEMDRNVLER MVAPLEHMLR NAVDHGLEST EKRIAAGKPE QGHISLELMY EGGDMVIELS      1620
     DDGSGVDLAA VRRKAIKRGM IHPDADLSDH EVLPFILQAG FSTSEIITQI SGRGVGMDVV      1680
     HAEVKQLGGS MVIDSVPGKG TRFRIRLPIS VSVNRALMVT CGEEQYAVPL NTVDGIVRVM      1740
     ANELDGYYQT SPPRYQYGGR SYELRYLGEL LGSSPPRLAG QLQPLPVLLV HLQDQWVAVQ      1800
     VDALAGSREI VVKSLGPQFS RVQGISGATI LGDGQVVLIL DLMAQIRNLQ GLPFRGLMAP      1860
     AYHEVEHARP LLVMVVDDSV TVRKVTSRLL ERHGMHVLTA KDGVDAMTLL QEHTPDIMLL      1920
     DIEMPRMDGF EVASQIRQDE QLKDLPIIMI TSRSGQKHRD RAMAVGVNEY LSKPYQETVL      1980
     LESIAYWSQA HV                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page