(data stored in SCRATCH zone)

EMBL: CP000075.PE499

CP000075.PE499       Location/Qualifiers
FT   CDS             540894..542498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0499"
FT                   /product="Urea amidolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35569"
FT                   /db_xref="GOA:Q4ZZ53"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ53"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35569.1"
FT                   /translation="MRFYPANLDALLVELSNLDETLALFESLQQMPIAGVEEIVPAART
FT                   LLVHFRPSAIGFEALATQIASRDIRGKAREAGKLIEIPVHYNGEDLADVARELDISVEE
FT                   VIKRHTSSDYNVAFCGFAPGFAYLSGGAGFVVPRRSTPRTRIPAGAVALAGGFSGIYPQ
FT                   ASPGGWQIIGVTTSTMWDLGRDEPALLQPGYRVRFQDAGPLPETRVQVAAPVRPQATTV
FT                   SEDYLQIETPGLQTLFQDLGRPGRAGQGVSASGALDRGALRAANRAVGNDPATACLEIL
FT                   MGGLTFTCQGQTVVAITGAQVSVEVLTAEGQKLRPLLYAPFSLQNGDQVSIGSPTAGLR
FT                   NYLAVRGGFIHEPVLGSLSTDTLAQVGPAALAAGDRLGFTRRTGGLSVSTAEQPAFEMP
FT                   RSDEVITLDVVMGPRSDWFSAEAQQLLAQQTWLVTPQSNRIGIRLAGEQSLQRAVDGEL
FT                   PSEGTTVGAIQVPPSGQPVLFLADHPLTGGYPVIGAVATYHLDKAGQIPVNARIRFNPL
FT                   SAFEPVRPATSDETKNR"
     MRFYPANLDA LLVELSNLDE TLALFESLQQ MPIAGVEEIV PAARTLLVHF RPSAIGFEAL        60
     ATQIASRDIR GKAREAGKLI EIPVHYNGED LADVARELDI SVEEVIKRHT SSDYNVAFCG       120
     FAPGFAYLSG GAGFVVPRRS TPRTRIPAGA VALAGGFSGI YPQASPGGWQ IIGVTTSTMW       180
     DLGRDEPALL QPGYRVRFQD AGPLPETRVQ VAAPVRPQAT TVSEDYLQIE TPGLQTLFQD       240
     LGRPGRAGQG VSASGALDRG ALRAANRAVG NDPATACLEI LMGGLTFTCQ GQTVVAITGA       300
     QVSVEVLTAE GQKLRPLLYA PFSLQNGDQV SIGSPTAGLR NYLAVRGGFI HEPVLGSLST       360
     DTLAQVGPAA LAAGDRLGFT RRTGGLSVST AEQPAFEMPR SDEVITLDVV MGPRSDWFSA       420
     EAQQLLAQQT WLVTPQSNRI GIRLAGEQSL QRAVDGELPS EGTTVGAIQV PPSGQPVLFL       480
     ADHPLTGGYP VIGAVATYHL DKAGQIPVNA RIRFNPLSAF EPVRPATSDE TKNR             534
//

If you have problems or comments...

PBIL Back to PBIL home page