(data stored in ACNUC7421 zone)

EMBL: CP000075.PE5

CP000075.PE5         Location/Qualifiers
FT   CDS             complement(6282..7169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35079"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q500U3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35079.1"
FT                   /translation="MQRLNLVARSVLASSTMLCWSTVTHALEITAGDYEPLPVGMNALL
FT                   VYAQHAESSDFYSNGQKVSDDFRLKTDVSLLRYIHSFALSNNAVIEPQFILPYGHLKAG
FT                   GEASALGQTTGAGDLILGAPVKWTLATANKDVFSVAPYLYLPTGSYENDDTLNLGENRW
FT                   RLLLQAAYIHHFNARWALDTAADVSWFSDNDDYGSGSDTLAQKTRYEYQAYLSYNVSPQ
FT                   TRFAVGGGHIDGGENRVGGVNQDDQLSTTYLRVSATHMLTPSIQVQAVLGRDVEVEEGF
FT                   REKSRLNLRLAKLF"
     MQRLNLVARS VLASSTMLCW STVTHALEIT AGDYEPLPVG MNALLVYAQH AESSDFYSNG        60
     QKVSDDFRLK TDVSLLRYIH SFALSNNAVI EPQFILPYGH LKAGGEASAL GQTTGAGDLI       120
     LGAPVKWTLA TANKDVFSVA PYLYLPTGSY ENDDTLNLGE NRWRLLLQAA YIHHFNARWA       180
     LDTAADVSWF SDNDDYGSGS DTLAQKTRYE YQAYLSYNVS PQTRFAVGGG HIDGGENRVG       240
     GVNQDDQLST TYLRVSATHM LTPSIQVQAV LGRDVEVEEG FREKSRLNLR LAKLF            295
//

If you have problems or comments...

PBIL Back to PBIL home page