(data stored in SCRATCH zone)

EMBL: CP000075.PE50

CP000075.PE50        Location/Qualifiers
FT   CDS             complement(51165..51797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0050"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35124"
FT                   /db_xref="GOA:Q500P8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35124.1"
FT                   /translation="MALETWLGFFAACWIISLSPGAGAIASMSCGLQYGFWRGYWNALG
FT                   LQIALVAQIAIVAAGLGAVLAASDMAFTLIKWFGVAYLVYLGIKQWRALPADLADESAV
FT                   RPVGKPMTLVLRGFLVNISNPKALIFILAILPQFIDPAAPLLIQYAIIAATMVVVDLIV
FT                   MAGYTGLASKVLRLLKTPRQQRRMNRTFASLFVGAAGFLATLHRGTA"
     MALETWLGFF AACWIISLSP GAGAIASMSC GLQYGFWRGY WNALGLQIAL VAQIAIVAAG        60
     LGAVLAASDM AFTLIKWFGV AYLVYLGIKQ WRALPADLAD ESAVRPVGKP MTLVLRGFLV       120
     NISNPKALIF ILAILPQFID PAAPLLIQYA IIAATMVVVD LIVMAGYTGL ASKVLRLLKT       180
     PRQQRRMNRT FASLFVGAAG FLATLHRGTA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page