(data stored in SCRATCH zone)

EMBL: CP000075.PE500

CP000075.PE500       Location/Qualifiers
FT   CDS             542495..544228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0500"
FT                   /product="biotin carboxyl carrier protein / biotin
FT                   carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35570"
FT                   /db_xref="GOA:Q4ZZ52"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35570.1"
FT                   /translation="MKKVLIANRGEIAVRIARACRDYGVASVAVYADADIDALHVRQAD
FT                   EAYGLQGERPTDTYLNIEKLLAVAARAGADAVHPGYGFLSERAEFARAVIDAGLIWIGP
FT                   DPATIDALGDKVQARRIALKVGAPLVAGTEDPVNDASEVVAFAEQHGLPIAIKAAFGGG
FT                   GRGLKVAWKLDEVSELYESAVREALTAFGRGECFVERFLDRPRHIEAQIIADRHGRVVV
FT                   VGTRDCSLQRRNQKLIEEAPAPYLNDELRQRIHESARAVCAEAGYVGAGTVEFLLSGDG
FT                   TLSFLEVNTRLQVEHPVTEETSGVDLVIEQLRVADGLPLSFDGTPVPRGHSFEFRINAE
FT                   DAGNGFLPTPGSITLFQPPSGPGVRLDTGVAEGSRVSPNFDSMIAKLIVTGATREQAIS
FT                   RARRALAEFKVEGVATVLPFHRAVMDHADFTAANTFAVHTRWIETDFAEHVTIAPRNAE
FT                   PVDPGVLRTFVEIDGKRHELGLPAELLAGMSLNAAAPADASQPVADAPDPHAVLTPVAG
FT                   NLHAWAVEDGATVEKGQVIAIMEAMKMETSILAPCAGTVQIGKEPGGYLEAKVVIGRVE
FT                   A"
     MKKVLIANRG EIAVRIARAC RDYGVASVAV YADADIDALH VRQADEAYGL QGERPTDTYL        60
     NIEKLLAVAA RAGADAVHPG YGFLSERAEF ARAVIDAGLI WIGPDPATID ALGDKVQARR       120
     IALKVGAPLV AGTEDPVNDA SEVVAFAEQH GLPIAIKAAF GGGGRGLKVA WKLDEVSELY       180
     ESAVREALTA FGRGECFVER FLDRPRHIEA QIIADRHGRV VVVGTRDCSL QRRNQKLIEE       240
     APAPYLNDEL RQRIHESARA VCAEAGYVGA GTVEFLLSGD GTLSFLEVNT RLQVEHPVTE       300
     ETSGVDLVIE QLRVADGLPL SFDGTPVPRG HSFEFRINAE DAGNGFLPTP GSITLFQPPS       360
     GPGVRLDTGV AEGSRVSPNF DSMIAKLIVT GATREQAISR ARRALAEFKV EGVATVLPFH       420
     RAVMDHADFT AANTFAVHTR WIETDFAEHV TIAPRNAEPV DPGVLRTFVE IDGKRHELGL       480
     PAELLAGMSL NAAAPADASQ PVADAPDPHA VLTPVAGNLH AWAVEDGATV EKGQVIAIME       540
     AMKMETSILA PCAGTVQIGK EPGGYLEAKV VIGRVEA                                577
//

If you have problems or comments...

PBIL Back to PBIL home page