(data stored in ACNUC7421 zone)

EMBL: CP000075.PE503

CP000075.PE503       Location/Qualifiers
FT   CDS             549707..552841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0503"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35573"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ49"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35573.1"
FT                   /translation="MDDEFAAHYDFDDADRAGDDDSDAAFRKRVDEDFSVSDYFRLNPI
FT                   NLQSPAALAARDVAQECQSRWGVEIDPDDTLIATLYIEDPRLYPAPHRANVVHSMTLTQ
FT                   ALLRNWQQKGNGNWFDHLGHLQPHSDGGFDCQVVDEKLLASDCVAYEAIYRKTSPQRYD
FT                   ATTQLGINAEAFKQYIWDHNLQSGYIAYLKQFWHAHGEDYNLMLKAGLFKAAWLQADEN
FT                   TLKAEHKAMVLEALGLPGDQGWKTLSFDDFVAAPIATRVTISELLVHGYSAVDIMVIRS
FT                   ADSPTVLLYIPGNSSPIHAFKNADELKEWVALMCRDPGKRRSLEAHFSAADDLDGFFYS
FT                   GVATALKGFAVYPKLLDSATGAWNPRKLVQFGEPLQPWPFSHFKTRVRAKSEIDALQKI
FT                   RSHGDYWKEEASSGLSECVSVLGGVAIVFPELMPVVAGLSLALVGLGVDAAVNGHTLEE
FT                   RQAGLGRIAFGVLNALPILGEEGEAVEAGVETGLVDETGGGYEVPGASTEIDPVIDIEP
FT                   APVFRPEPPALRSLDKKMRRLLRALEAPQELPGLASGEVAGIYPLEGKRYIELHDRAFR
FT                   VEWVPQEKQYRIRSAADPRVWGPYVKTVDTGYWDLDLKLGLRGGESFDGTQLPPASEAE
FT                   SVVVPVVPGEPKIEVQRWAPKLQVELPMDGISIEEVLSQSRGTVIEKYFVQVRGEKTNV
FT                   YYDPDIRCWRTDPSDRDGLVWLDRDGVWNRGSKDTFQKLEANLPQSQRFEFYTFPRVPS
FT                   LPADAKPISRIVHHIWMGERTPGADLLEKMLSNMRTSPDLRFQLHIDIDDPAADQQLFD
FT                   YFFEQPQMHISRLKEEAFYPDFLSGENGEAFNYFRHSDNRNYAAASDILRYRLIDEYGG
FT                   IYVDCDDTINVPFAKFPLKAGPNDVLLGRELQAEHLGYKGPGNSHFGSHPNNPVLKQML
FT                   KEIKVRFDSEKQINEAFFSTRRPYIDRTDDATKAASKARMTPYMTRISDLTGPKLMSDV
FT                   LRRLRPDCFDLLARSYLPPDQVLSVIYEAYLKDTVDFYFPFKATAKITPGSANEW"
     MDDEFAAHYD FDDADRAGDD DSDAAFRKRV DEDFSVSDYF RLNPINLQSP AALAARDVAQ        60
     ECQSRWGVEI DPDDTLIATL YIEDPRLYPA PHRANVVHSM TLTQALLRNW QQKGNGNWFD       120
     HLGHLQPHSD GGFDCQVVDE KLLASDCVAY EAIYRKTSPQ RYDATTQLGI NAEAFKQYIW       180
     DHNLQSGYIA YLKQFWHAHG EDYNLMLKAG LFKAAWLQAD ENTLKAEHKA MVLEALGLPG       240
     DQGWKTLSFD DFVAAPIATR VTISELLVHG YSAVDIMVIR SADSPTVLLY IPGNSSPIHA       300
     FKNADELKEW VALMCRDPGK RRSLEAHFSA ADDLDGFFYS GVATALKGFA VYPKLLDSAT       360
     GAWNPRKLVQ FGEPLQPWPF SHFKTRVRAK SEIDALQKIR SHGDYWKEEA SSGLSECVSV       420
     LGGVAIVFPE LMPVVAGLSL ALVGLGVDAA VNGHTLEERQ AGLGRIAFGV LNALPILGEE       480
     GEAVEAGVET GLVDETGGGY EVPGASTEID PVIDIEPAPV FRPEPPALRS LDKKMRRLLR       540
     ALEAPQELPG LASGEVAGIY PLEGKRYIEL HDRAFRVEWV PQEKQYRIRS AADPRVWGPY       600
     VKTVDTGYWD LDLKLGLRGG ESFDGTQLPP ASEAESVVVP VVPGEPKIEV QRWAPKLQVE       660
     LPMDGISIEE VLSQSRGTVI EKYFVQVRGE KTNVYYDPDI RCWRTDPSDR DGLVWLDRDG       720
     VWNRGSKDTF QKLEANLPQS QRFEFYTFPR VPSLPADAKP ISRIVHHIWM GERTPGADLL       780
     EKMLSNMRTS PDLRFQLHID IDDPAADQQL FDYFFEQPQM HISRLKEEAF YPDFLSGENG       840
     EAFNYFRHSD NRNYAAASDI LRYRLIDEYG GIYVDCDDTI NVPFAKFPLK AGPNDVLLGR       900
     ELQAEHLGYK GPGNSHFGSH PNNPVLKQML KEIKVRFDSE KQINEAFFST RRPYIDRTDD       960
     ATKAASKARM TPYMTRISDL TGPKLMSDVL RRLRPDCFDL LARSYLPPDQ VLSVIYEAYL      1020
     KDTVDFYFPF KATAKITPGS ANEW                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page