(data stored in ACNUC7421 zone)

EMBL: CP000075.PE504

CP000075.PE504       Location/Qualifiers
FT   CDS             552941..555589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0504"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35574"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35574.1"
FT                   /translation="MTSLTQEDVMSPPPSQASKTDQQLLRERAQQFVLDYPDLHDLAYI
FT                   AASKIILQHTHRMFNPEKVYWHRFGSASSSPRTFTGWQHSGKPVQSMTLIELLIKHFSA
FT                   HDQEASDELSLYGGFYTDGPDHGFFDERNEVPMLPQDVLNDMWTLDFSSLYSRRMERFW
FT                   NTHSDNFCILAKAQYLVAAGHCLRKGQLSPDDFKQVTRVVIADPLQTPTLKALQEPLPL
FT                   PPGVSVHTLDIDGIKAHDLLRIVIAGGREVIYWPDAEQPFMAFDSERALYHWLKEQFMG
FT                   EQAAKAMTGHFLRGEASRTQDGARFARAVSDLLAHDWRADVRLINQSQAPIAGDPFVYL
FT                   RDVARQAMSADAREILTSNTDLLKQIWIGYLSAFLRAFGGLAPLSWPVALTLVGASLAN
FT                   TGLNIDQAVNGKTPAQRKAGVLGAILNTLYLLFNLPLLMSIRVAPQPLQVTTTDVASIS
FT                   SEALEGGSVLADPLDNMEGNLLLDTLTPSAEEGRLRGVYTLGNGETWIKLAHLPYRVMF
FT                   NEQQQCWMVVNPDNPFAFIGSKPVRLNAEGKWTLMASPGLQGGSPMDVQIPSGSASAPV
FT                   GKPYATVGSSFWDRYLQTDIFNEQHFAETALARQKQVMSIWDATPEDVLESDSSPDGNE
FT                   VYRDPWQGKHRVFKLGDDDYYAANITLYTQDDAQFNRFLRTGESLGRNQVRAIERLADD
FT                   IHVVGYNNDVELYRGGSGDRGTSGAVFRSGQIKVGDVLVNTDVTSFSENPYVVSAFASS
FT                   RAGAPASAMLGPVTFDDTSVVFVLPKGRYLRATPVAPFSASPDEAESIFLPGCYFQIDS
FT                   IEEVSGEFYRIMKVQMQEVDRPIQGRALYDMRTGEPFSREQYALKLGTDAKVLVDRFFP
FT                   QNPMTDLFSPR"
     MTSLTQEDVM SPPPSQASKT DQQLLRERAQ QFVLDYPDLH DLAYIAASKI ILQHTHRMFN        60
     PEKVYWHRFG SASSSPRTFT GWQHSGKPVQ SMTLIELLIK HFSAHDQEAS DELSLYGGFY       120
     TDGPDHGFFD ERNEVPMLPQ DVLNDMWTLD FSSLYSRRME RFWNTHSDNF CILAKAQYLV       180
     AAGHCLRKGQ LSPDDFKQVT RVVIADPLQT PTLKALQEPL PLPPGVSVHT LDIDGIKAHD       240
     LLRIVIAGGR EVIYWPDAEQ PFMAFDSERA LYHWLKEQFM GEQAAKAMTG HFLRGEASRT       300
     QDGARFARAV SDLLAHDWRA DVRLINQSQA PIAGDPFVYL RDVARQAMSA DAREILTSNT       360
     DLLKQIWIGY LSAFLRAFGG LAPLSWPVAL TLVGASLANT GLNIDQAVNG KTPAQRKAGV       420
     LGAILNTLYL LFNLPLLMSI RVAPQPLQVT TTDVASISSE ALEGGSVLAD PLDNMEGNLL       480
     LDTLTPSAEE GRLRGVYTLG NGETWIKLAH LPYRVMFNEQ QQCWMVVNPD NPFAFIGSKP       540
     VRLNAEGKWT LMASPGLQGG SPMDVQIPSG SASAPVGKPY ATVGSSFWDR YLQTDIFNEQ       600
     HFAETALARQ KQVMSIWDAT PEDVLESDSS PDGNEVYRDP WQGKHRVFKL GDDDYYAANI       660
     TLYTQDDAQF NRFLRTGESL GRNQVRAIER LADDIHVVGY NNDVELYRGG SGDRGTSGAV       720
     FRSGQIKVGD VLVNTDVTSF SENPYVVSAF ASSRAGAPAS AMLGPVTFDD TSVVFVLPKG       780
     RYLRATPVAP FSASPDEAES IFLPGCYFQI DSIEEVSGEF YRIMKVQMQE VDRPIQGRAL       840
     YDMRTGEPFS REQYALKLGT DAKVLVDRFF PQNPMTDLFS PR                          882
//

If you have problems or comments...

PBIL Back to PBIL home page