(data stored in SCRATCH zone)

EMBL: CP000075.PE511

CP000075.PE511       Location/Qualifiers
FT   CDS             567369..567665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35581"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ41"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35581.1"
FT                   /translation="MQVSKTKSSFYRRLYVAYLIDSQIASSVPELIAATGMPRRTAQDT
FT                   ISALADLDIVCDFEQLEGGRNHAGSYRIRDWGAVDKGWIADNLPRIKAVLEYP"
     MQVSKTKSSF YRRLYVAYLI DSQIASSVPE LIAATGMPRR TAQDTISALA DLDIVCDFEQ        60
     LEGGRNHAGS YRIRDWGAVD KGWIADNLPR IKAVLEYP                                98
//

If you have problems or comments...

PBIL Back to PBIL home page