(data stored in ACNUC7421 zone)

EMBL: CP000075.PE513

CP000075.PE513       Location/Qualifiers
FT   CDS             568358..569113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0513"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35583"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ39"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35583.1"
FT                   /translation="MSQLLRAVGVLVFLLMAHVNAAEKLRLVADPWPPFTDALLLNGGL
FT                   ATDIVNTALRRAGYTTLYEQVPWARAMLGLSQGRHDVLINAWFSDERTKIGQFSAQYLL
FT                   NRIRFIKRKESPIGTLTHEQLHQYVIAVVRGYAYAPAFDSDSQLQKVPVQNFSTAIRML
FT                   AAERVDLTLEDEYVARYNLAMERDEVRDRVEFLPGSLSENSLHILVSLKNPHHDKIVAD
FT                   FDREIAAMKADGTYDELLRLHGLQQPPEL"
     MSQLLRAVGV LVFLLMAHVN AAEKLRLVAD PWPPFTDALL LNGGLATDIV NTALRRAGYT        60
     TLYEQVPWAR AMLGLSQGRH DVLINAWFSD ERTKIGQFSA QYLLNRIRFI KRKESPIGTL       120
     THEQLHQYVI AVVRGYAYAP AFDSDSQLQK VPVQNFSTAI RMLAAERVDL TLEDEYVARY       180
     NLAMERDEVR DRVEFLPGSL SENSLHILVS LKNPHHDKIV ADFDREIAAM KADGTYDELL       240
     RLHGLQQPPE L                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page