(data stored in SCRATCH zone)

EMBL: CP000075.PE514

CP000075.PE514       Location/Qualifiers
FT   CDS             complement(569076..571274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0514"
FT                   /product="Intergral membrane protein, YccS:Integral
FT                   membrane protein, YccS/YhfK"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35584"
FT                   /db_xref="GOA:Q4ZZ38"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ38"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35584.1"
FT                   /translation="MASKSLRHTFRRLWALDKFSYSVRVFIALTGSMALCWYQNEMALL
FT                   IPLFLGIIACALAETDDSWQGRLNALAVTLVCFSIAALAVELLFPYPILFVCSLALASF
FT                   CLTMLGALGERYGAIAYGTLILSVYTMIGVDQRGGEVLDFWHEPMLLVAGAAWYGLLSV
FT                   LWQMLFSNQPVQQALARLFRELGQYLKLKSTLFEPIRTLNVEARRLELAQQNGKVVAAL
FT                   NSTKEIILHRVGSGRPGSKVSRYLKLYFIAQDIHERASSSHYPYNSLADAFFHSDVLFR
FT                   CQRLLRQQGVACQALSESIQLRQPFVYDPSFAEAMEDLHASLEHLRIQSNPAWRGLLRS
FT                   LRALAANLGTLDRLISDASNPDAVADATDSSLLDRSPRNLKDVWTRLRLQMTPTSLLFR
FT                   HALRLPLALTIGYAMVHLIHPSQGYWIILTTVFVCQPSYGATRLKLGQRIIGTAIGLTV
FT                   GWVLFDLVTSPILQSMCAVLAGVVFFVNRTTRYTLSTAAITVMVLFCFNQVGDGYGLFL
FT                   PRLFDTLLGSLIAGLAVFLFLPDWQGRRLNKVLANTLTCNSIYLRQIMQQYAKGKSDDL
FT                   AYRLARRNAHNADAALSTTLANMLMEPGHFRKEADVGFRFLVLSHTLLSYLSGLGAHRD
FT                   TQLPSDVREHLIDNVGATLAASIDEIAAGLAEKKPVAVQSDAEEGLAAQLEQLPEDMDE
FT                   SQRLVQAQLALICRQLAPLRTLAAHLIKAPEVAATHAV"
     MASKSLRHTF RRLWALDKFS YSVRVFIALT GSMALCWYQN EMALLIPLFL GIIACALAET        60
     DDSWQGRLNA LAVTLVCFSI AALAVELLFP YPILFVCSLA LASFCLTMLG ALGERYGAIA       120
     YGTLILSVYT MIGVDQRGGE VLDFWHEPML LVAGAAWYGL LSVLWQMLFS NQPVQQALAR       180
     LFRELGQYLK LKSTLFEPIR TLNVEARRLE LAQQNGKVVA ALNSTKEIIL HRVGSGRPGS       240
     KVSRYLKLYF IAQDIHERAS SSHYPYNSLA DAFFHSDVLF RCQRLLRQQG VACQALSESI       300
     QLRQPFVYDP SFAEAMEDLH ASLEHLRIQS NPAWRGLLRS LRALAANLGT LDRLISDASN       360
     PDAVADATDS SLLDRSPRNL KDVWTRLRLQ MTPTSLLFRH ALRLPLALTI GYAMVHLIHP       420
     SQGYWIILTT VFVCQPSYGA TRLKLGQRII GTAIGLTVGW VLFDLVTSPI LQSMCAVLAG       480
     VVFFVNRTTR YTLSTAAITV MVLFCFNQVG DGYGLFLPRL FDTLLGSLIA GLAVFLFLPD       540
     WQGRRLNKVL ANTLTCNSIY LRQIMQQYAK GKSDDLAYRL ARRNAHNADA ALSTTLANML       600
     MEPGHFRKEA DVGFRFLVLS HTLLSYLSGL GAHRDTQLPS DVREHLIDNV GATLAASIDE       660
     IAAGLAEKKP VAVQSDAEEG LAAQLEQLPE DMDESQRLVQ AQLALICRQL APLRTLAAHL       720
     IKAPEVAATH AV                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page