(data stored in ACNUC7421 zone)

EMBL: CP000075.PE515

CP000075.PE515       Location/Qualifiers
FT   CDS             complement(571412..572590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0515"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35585"
FT                   /db_xref="GOA:Q4ZZ37"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ37"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35585.1"
FT                   /translation="MPVTDVVIIGAGAAGLMCAFTAAARGRKVMLIDHANKPGKKILMS
FT                   GGGRCNFTNMYTEPANFLSQNPHFCKSALARYTQWDFIAMVAKHGVPYHEKKLGQLFCD
FT                   NKSSDILEMLLEECRQAGVSLHMDTAVQQIEKTDDGYSLQTTLGTLNCQSLVIATGGLS
FT                   IPTLGATGFGYQVGKQFGHTLLPTRAGLVPFTITDQLKELCTELSGTSVDCLVSCNDTS
FT                   FRENILFTHRGLSGPAILQISSFWQPGDTVEINLLPDHDVPAWLNQQQAERPNSELKTL
FT                   LGEIFTKKMANLIAEHWFVSRPMKQYTHAELAEIAEKLASWQVVPAGTEGYRTAEVTLG
FT                   GIDTREVSSKTMESLKSPGLYFVGEVLDVSGHLGGFNFQWAWASAYAAAHYV"
     MPVTDVVIIG AGAAGLMCAF TAAARGRKVM LIDHANKPGK KILMSGGGRC NFTNMYTEPA        60
     NFLSQNPHFC KSALARYTQW DFIAMVAKHG VPYHEKKLGQ LFCDNKSSDI LEMLLEECRQ       120
     AGVSLHMDTA VQQIEKTDDG YSLQTTLGTL NCQSLVIATG GLSIPTLGAT GFGYQVGKQF       180
     GHTLLPTRAG LVPFTITDQL KELCTELSGT SVDCLVSCND TSFRENILFT HRGLSGPAIL       240
     QISSFWQPGD TVEINLLPDH DVPAWLNQQQ AERPNSELKT LLGEIFTKKM ANLIAEHWFV       300
     SRPMKQYTHA ELAEIAEKLA SWQVVPAGTE GYRTAEVTLG GIDTREVSSK TMESLKSPGL       360
     YFVGEVLDVS GHLGGFNFQW AWASAYAAAH YV                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page