(data stored in ACNUC7421 zone)

EMBL: CP000075.PE523

CP000075.PE523       Location/Qualifiers
FT   CDS             585620..586426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0523"
FT                   /product="Lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35593"
FT                   /db_xref="GOA:Q4ZZ29"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ29"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35593.1"
FT                   /translation="MKLFLAEPFKSLWAERDAFVEVEGLSGEVYRELEGRRTLRTEVDG
FT                   RGYFVKIHRGIGWGEIAKNLATAKLPVLGAGKEWDAIERLHEVGVPTMTAVAYGERGSN
FT                   PAAQHSFIVTEELAPTISLEDISLNWRSEPPEPRLKRAFIAEVARMVGMMHRAGVNHRD
FT                   CYICHFLLHTDKPVTADDFKLSVIDLHRAQTRRAITPRWRNKDLAALYFSALDIGLTRR
FT                   DKLRFLKGYFQKPLREILLKEATLLTWLDKKADKLYQRKVRYGDAL"
     MKLFLAEPFK SLWAERDAFV EVEGLSGEVY RELEGRRTLR TEVDGRGYFV KIHRGIGWGE        60
     IAKNLATAKL PVLGAGKEWD AIERLHEVGV PTMTAVAYGE RGSNPAAQHS FIVTEELAPT       120
     ISLEDISLNW RSEPPEPRLK RAFIAEVARM VGMMHRAGVN HRDCYICHFL LHTDKPVTAD       180
     DFKLSVIDLH RAQTRRAITP RWRNKDLAAL YFSALDIGLT RRDKLRFLKG YFQKPLREIL       240
     LKEATLLTWL DKKADKLYQR KVRYGDAL                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page