(data stored in ACNUC7421 zone)

EMBL: CP000075.PE525

CP000075.PE525       Location/Qualifiers
FT   CDS             587157..587936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0525"
FT                   /product="Lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35595"
FT                   /db_xref="GOA:Q4ZZ27"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ27"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35595.1"
FT                   /translation="MSVFIASADQPLLARHNLADFESLWNIRLDAVDEPNTGRGGWSSV
FT                   FRLDLDGQGFYLKRQSNYLTHTLHHPFGEPSFSREFRNISRYRKLGIPALQAVFYGERK
FT                   VDGERRAILMTRALDGWTDLDELLQQWNQMEAPQRQAILHACGQLARTLHRAGQVHGCF
FT                   YPKHIFLQAAGTGYQAQLIDLEKTRPVIFGKRDLARDLEPLLRRAPMWNEADRRELLAA
FT                   YLHATPNSLLVDAWSARLGKRGAHKRDLQHSDDKETR"
     MSVFIASADQ PLLARHNLAD FESLWNIRLD AVDEPNTGRG GWSSVFRLDL DGQGFYLKRQ        60
     SNYLTHTLHH PFGEPSFSRE FRNISRYRKL GIPALQAVFY GERKVDGERR AILMTRALDG       120
     WTDLDELLQQ WNQMEAPQRQ AILHACGQLA RTLHRAGQVH GCFYPKHIFL QAAGTGYQAQ       180
     LIDLEKTRPV IFGKRDLARD LEPLLRRAPM WNEADRRELL AAYLHATPNS LLVDAWSARL       240
     GKRGAHKRDL QHSDDKETR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page