(data stored in SCRATCH zone)

EMBL: CP000075.PE526

CP000075.PE526       Location/Qualifiers
FT   CDS             587936..589381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35596"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ26"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35596.1"
FT                   /translation="MRLSELKTAGRTPELPMSLTLADAAGSAELQLLTLLRVLPGQRYV
FT                   GAGVWRGRTVLAKLLVGDKAARHFQRELVGVRLLAEQGLTTPLLLADGLQDGEGGWLLF
FT                   EFLEQAPSLGDAWNAVQHLPPLADEQQAVLGEALSAIARQHAKGLWQEDLHLDNLLRHN
FT                   GQLYLIDGAGIRAEQAGTPLSRQKVLENLGVFFAQLPRSFEPFTEELLVHYLLSNAEHG
FT                   LPMEALQKQIDKVRSWRLKDFMSKTVRDCSLFSVEDSASVFRAIRREEESAMLPVLSQA
FT                   DALLDQGHLYKTGGAASVGRVEVSGRPLVIKRYNIKNFSHWLKRFWRPSRAWHSWREGN
FT                   RLKFLGIATPKPLAVQEKRFLGLRSKAWLVTEFIDGPDIIERFAPYVESGDAPEVELQA
FT                   LDRLFVQLIQARISHGDFKGHNLFWHVDRWAMIDLDAMQQHSSQSSFAAAYARDRARFM
FT                   RNWPAHSALHQLLEQRLPKLASD"
     MRLSELKTAG RTPELPMSLT LADAAGSAEL QLLTLLRVLP GQRYVGAGVW RGRTVLAKLL        60
     VGDKAARHFQ RELVGVRLLA EQGLTTPLLL ADGLQDGEGG WLLFEFLEQA PSLGDAWNAV       120
     QHLPPLADEQ QAVLGEALSA IARQHAKGLW QEDLHLDNLL RHNGQLYLID GAGIRAEQAG       180
     TPLSRQKVLE NLGVFFAQLP RSFEPFTEEL LVHYLLSNAE HGLPMEALQK QIDKVRSWRL       240
     KDFMSKTVRD CSLFSVEDSA SVFRAIRREE ESAMLPVLSQ ADALLDQGHL YKTGGAASVG       300
     RVEVSGRPLV IKRYNIKNFS HWLKRFWRPS RAWHSWREGN RLKFLGIATP KPLAVQEKRF       360
     LGLRSKAWLV TEFIDGPDII ERFAPYVESG DAPEVELQAL DRLFVQLIQA RISHGDFKGH       420
     NLFWHVDRWA MIDLDAMQQH SSQSSFAAAY ARDRARFMRN WPAHSALHQL LEQRLPKLAS       480
     D                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page