(data stored in SCRATCH zone)

EMBL: CP000075.PE53

CP000075.PE53        Location/Qualifiers
FT   CDS             54432..54908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35127"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35127.1"
FT                   /translation="MPSALWSFTLDFYARPGVEQACLTLQANGANVCMVLCGVWLGTRD
FT                   VACDAQRVAQIKQLATPWHDDVVRPLRDLRNQWRHAALEDAQLSALRMKVKALELEAEQ
FT                   GLMMKLEALTGDWPAGEARNAEEWLLELAEVDAEKNRDALHVLRIAVGLAVDQT"
     MPSALWSFTL DFYARPGVEQ ACLTLQANGA NVCMVLCGVW LGTRDVACDA QRVAQIKQLA        60
     TPWHDDVVRP LRDLRNQWRH AALEDAQLSA LRMKVKALEL EAEQGLMMKL EALTGDWPAG       120
     EARNAEEWLL ELAEVDAEKN RDALHVLRIA VGLAVDQT                               158
//

If you have problems or comments...

PBIL Back to PBIL home page