(data stored in ACNUC7421 zone)

EMBL: CP000075.PE531

CP000075.PE531       Location/Qualifiers
FT   CDS             599742..601151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0531"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35601"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35601.1"
FT                   /translation="MSRKQQLLKRHRRNKRLALLGGLLLLIAVGVLVAWWLAPVLAVCA
FT                   WVAHEAWFADHLFYSPSDDYQYTFAADSEVPGVRLDGGTLLIDPAVQLNGDETLILALT
FT                   VKSTWLGRFLDPVVELQGQGLNDQQAFERGVCGVRYLNLTGLGEPLAAGVLKLRGRCCR
FT                   LAGTPRLWLFRQPDARKQRVMVIAPHADDAELAAFGLYSQAEEAWIITLTAGEIEAEHY
FT                   RQMGMERAEAARMKGRLRAWDSIAVARWGGVPESQCVQLGYFCLQLPAMQAAPDTPVGS
FT                   READLTDTRLFRQFNTLPLPGDNGQPTWNNLLADLRALILKARPQVVVMPHPAIDPHPD
FT                   HICAQAAVREALLGLEWQPDVVLGYANHLHDNDRWPMGDAYSGISLPPVFDATLPLVPY
FT                   SLQLSVAAQRDKAMALGMMHDLLPRMPFKRRVRRALQRVLAGRHWPAEGENEFFRKAVR
FT                   RHELFWCSRDL"
     MSRKQQLLKR HRRNKRLALL GGLLLLIAVG VLVAWWLAPV LAVCAWVAHE AWFADHLFYS        60
     PSDDYQYTFA ADSEVPGVRL DGGTLLIDPA VQLNGDETLI LALTVKSTWL GRFLDPVVEL       120
     QGQGLNDQQA FERGVCGVRY LNLTGLGEPL AAGVLKLRGR CCRLAGTPRL WLFRQPDARK       180
     QRVMVIAPHA DDAELAAFGL YSQAEEAWII TLTAGEIEAE HYRQMGMERA EAARMKGRLR       240
     AWDSIAVARW GGVPESQCVQ LGYFCLQLPA MQAAPDTPVG SREADLTDTR LFRQFNTLPL       300
     PGDNGQPTWN NLLADLRALI LKARPQVVVM PHPAIDPHPD HICAQAAVRE ALLGLEWQPD       360
     VVLGYANHLH DNDRWPMGDA YSGISLPPVF DATLPLVPYS LQLSVAAQRD KAMALGMMHD       420
     LLPRMPFKRR VRRALQRVLA GRHWPAEGEN EFFRKAVRRH ELFWCSRDL                   469
//

If you have problems or comments...

PBIL Back to PBIL home page