(data stored in ACNUC7421 zone)

EMBL: CP000075.PE533

CP000075.PE533       Location/Qualifiers
FT   CDS             602170..602943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35603"
FT                   /db_xref="GOA:Q4ZZ19"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q4ZZ19"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35603.1"
FT                   /translation="MMVFSENSDITLVVTSCGRFDLLKRTLETFDHFNTAPIRHVLITE
FT                   DSGDDRVQACIPEHWHPHTRFIINNPKLGQMRSVDAAYSLIETSWVFHCEDDWDFYRPH
FT                   FIEESMTLLENDPQALQVWLRSYNHDLRIHSPYVYLNEREVVEGIAFYKLGSHKPEWQG
FT                   FSFNPGLRRLADYQQHAPYAEHGGEKKLSQLFAAQNRYALIMENDAVLHTGFGEHVEVP
FT                   QERLDKQRRKRRDRIKLIVAVLAGLVAGWLLNNVS"
     MMVFSENSDI TLVVTSCGRF DLLKRTLETF DHFNTAPIRH VLITEDSGDD RVQACIPEHW        60
     HPHTRFIINN PKLGQMRSVD AAYSLIETSW VFHCEDDWDF YRPHFIEESM TLLENDPQAL       120
     QVWLRSYNHD LRIHSPYVYL NEREVVEGIA FYKLGSHKPE WQGFSFNPGL RRLADYQQHA       180
     PYAEHGGEKK LSQLFAAQNR YALIMENDAV LHTGFGEHVE VPQERLDKQR RKRRDRIKLI       240
     VAVLAGLVAG WLLNNVS                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page