(data stored in ACNUC7421 zone)

EMBL: CP000075.PE54

CP000075.PE54        Location/Qualifiers
FT   CDS             complement(54905..55921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0054"
FT                   /product="alginate regulatory protein AlgR3"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35128"
FT                   /db_xref="GOA:Q500P4"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35128.1"
FT                   /translation="MSAKKKPVNTPLHLLQQLSGSLLEHLEDACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNSRIKLQDAATAGKSKAQAKAKGAVSELEELLDALKDRQTETRTYILH
FT                   LKRDAQESLKLAQGIGRVKEAVGKILTTRDAKPVAPKAVAKTPAAKAPAKTAAKAPVKT
FT                   AAAKPVAKAAAKPSAAAKPAAKTAVAKAPVKAAAKPAPRATAAAKPVAAKTTAAKPAAA
FT                   RTTAAKPAAAKPAATKAPVAKTTASNAAKPAAAKAAAAKAPVKAPVKAPAKAPAKAPVK
FT                   AAAKPVAKPAAKPAVKPAAAKPATPAPAAAKPTTPAPAAPAAAPATPANGATPTSAS"
     MSAKKKPVNT PLHLLQQLSG SLLEHLEDAC SQALADAEKL LAKLEKQRGK AQEKLHNSRI        60
     KLQDAATAGK SKAQAKAKGA VSELEELLDA LKDRQTETRT YILHLKRDAQ ESLKLAQGIG       120
     RVKEAVGKIL TTRDAKPVAP KAVAKTPAAK APAKTAAKAP VKTAAAKPVA KAAAKPSAAA       180
     KPAAKTAVAK APVKAAAKPA PRATAAAKPV AAKTTAAKPA AARTTAAKPA AAKPAATKAP       240
     VAKTTASNAA KPAAAKAAAA KAPVKAPVKA PAKAPAKAPV KAAAKPVAKP AAKPAVKPAA       300
     AKPATPAPAA AKPTTPAPAA PAAAPATPAN GATPTSAS                               338
//

If you have problems or comments...

PBIL Back to PBIL home page