(data stored in ACNUC7421 zone)

EMBL: CP000075.PE57

CP000075.PE57        Location/Qualifiers
FT   CDS             complement(57384..57536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35131"
FT                   /db_xref="UniProtKB/TrEMBL:Q500P1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35131.1"
FT                   /translation="MYELYLLRTLMALSSGHNLGRTRHWKYAVLTHLSGQVPANYQDRP
FT                   RTACP"
     MYELYLLRTL MALSSGHNLG RTRHWKYAVL THLSGQVPAN YQDRPRTACP                   50
//

If you have problems or comments...

PBIL Back to PBIL home page