(data stored in ACNUC7421 zone)

EMBL: CP000075.PE58

CP000075.PE58        Location/Qualifiers
FT   CDS             complement(57541..58068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0058"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35132"
FT                   /db_xref="GOA:Q500P0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q500P0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35132.1"
FT                   /translation="MYLARTRFLFFLASLACASIIGVAFYLQQAVGLDPCTLCMVQRAA
FT                   FIACGVLALCAACHAPGPTGTRRYSLGLLLVALAGLAGAGTQVWLQTASADQLIPFITR
FT                   LEQILSLLSLDMCIDRLRSDALFCAEITWTLFGISLPEWSLLAFTGLALLPLYPLFSEL
FT                   SHWLATRDRGGY"
     MYLARTRFLF FLASLACASI IGVAFYLQQA VGLDPCTLCM VQRAAFIACG VLALCAACHA        60
     PGPTGTRRYS LGLLLVALAG LAGAGTQVWL QTASADQLIP FITRLEQILS LLSLDMCIDR       120
     LRSDALFCAE ITWTLFGISL PEWSLLAFTG LALLPLYPLF SELSHWLATR DRGGY            175
//

If you have problems or comments...

PBIL Back to PBIL home page