(data stored in ACNUC7421 zone)

EMBL: CP000075.PE60

CP000075.PE60        Location/Qualifiers
FT   CDS             complement(59526..60701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0060"
FT                   /product="Protein of unknown function DUF513"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35134"
FT                   /db_xref="GOA:Q500N8"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35134.1"
FT                   /translation="MIDTCRLRYYAKMQRMGYVSETALPKDEESVLKTPASKPEPVRTE
FT                   RTGSRNSGLVFLALLLAIAGIAVAGWGVWQLRMLQAGHQQQRGQVEDIAEQTLVLAQND
FT                   QQLSARIAQFPPANQLEDSRRLVAQLQGDQQRLSQRLETVLGASRKDWRLAEAEHLLRL
FT                   ASLRLSALQDINSAQALVQGADEILREQDDPGSFAAREQLAKSLAALRSVEQPDRTGLF
FT                   LQLAALREQAVQLNKLAPEYADKGESLMGLTADKTETSRWSQWWDEISHYFRIDFNADK
FT                   DIRPVLAGQSLSQVRLALSLALEQAQWAALNGEPEVYSKAITEAQSVLKANFDQDDPQG
FT                   KALGQGLDAVASQPVSVKTPDLAPTLSAVQAYLERRHAAGQPAEAQQGTSR"
     MIDTCRLRYY AKMQRMGYVS ETALPKDEES VLKTPASKPE PVRTERTGSR NSGLVFLALL        60
     LAIAGIAVAG WGVWQLRMLQ AGHQQQRGQV EDIAEQTLVL AQNDQQLSAR IAQFPPANQL       120
     EDSRRLVAQL QGDQQRLSQR LETVLGASRK DWRLAEAEHL LRLASLRLSA LQDINSAQAL       180
     VQGADEILRE QDDPGSFAAR EQLAKSLAAL RSVEQPDRTG LFLQLAALRE QAVQLNKLAP       240
     EYADKGESLM GLTADKTETS RWSQWWDEIS HYFRIDFNAD KDIRPVLAGQ SLSQVRLALS       300
     LALEQAQWAA LNGEPEVYSK AITEAQSVLK ANFDQDDPQG KALGQGLDAV ASQPVSVKTP       360
     DLAPTLSAVQ AYLERRHAAG QPAEAQQGTS R                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page