(data stored in ACNUC7421 zone)

EMBL: CP000075.PE64

CP000075.PE64        Location/Qualifiers
FT   CDS             complement(63388..64470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0064"
FT                   /product="Sensory transduction protein kinase AlgZ"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35138"
FT                   /db_xref="GOA:Q500N4"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35138.1"
FT                   /translation="MRIEPVKHDARPAPGKDFFLPELCLPQALLVLVVLAELLVLVLVL
FT                   VEPMRSGFDWVRLALMSLFVQWIVLLSAALLCGLRPWLARLTPGLAGMLSCLLVVGLTL
FT                   LCTAVTDVCQLTGRISVSGMVERYLRYSTIALIMSALMLRYFYLQSQWRKQQQGELRAR
FT                   IESLQARIRPHFLFNTLNSIASLVASNPVKAEQAVLDLSDLFRASLAKPGSLVTWGEEL
FT                   ALAKRYLSIEQYRLGERLQLDWRVSAIPDDLPIPQLTLQPLLENALIYGIAPRVEGGVV
FT                   TVEANYEGGEFILSVSNPYEEVANRQTSNGTQQALTNIGARIAALFGPHASLSVERRDG
FT                   RHYTCLRYPCARLTQEARAI"
     MRIEPVKHDA RPAPGKDFFL PELCLPQALL VLVVLAELLV LVLVLVEPMR SGFDWVRLAL        60
     MSLFVQWIVL LSAALLCGLR PWLARLTPGL AGMLSCLLVV GLTLLCTAVT DVCQLTGRIS       120
     VSGMVERYLR YSTIALIMSA LMLRYFYLQS QWRKQQQGEL RARIESLQAR IRPHFLFNTL       180
     NSIASLVASN PVKAEQAVLD LSDLFRASLA KPGSLVTWGE ELALAKRYLS IEQYRLGERL       240
     QLDWRVSAIP DDLPIPQLTL QPLLENALIY GIAPRVEGGV VTVEANYEGG EFILSVSNPY       300
     EEVANRQTSN GTQQALTNIG ARIAALFGPH ASLSVERRDG RHYTCLRYPC ARLTQEARAI       360
//

If you have problems or comments...

PBIL Back to PBIL home page