(data stored in ACNUC7421 zone)

EMBL: CP000075.PE66

CP000075.PE66        Location/Qualifiers
FT   CDS             66405..67646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0066"
FT                   /product="bifunctional spore maturation protein, fused
FT                   SpmA/SpmB"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35140"
FT                   /db_xref="GOA:Q500N2"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q500N2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35140.1"
FT                   /translation="MLNGLWLGFFVVATISALVQWLVGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLRIAEKAGIVDWLAKVLGPLFLRLMPEVPPGHPALGLITLNFA
FT                   ANALGLDNAATPIGLKAMRSLQELNPSKTAASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTLVFLPILLATSVSTIVGLLSVAFMQRLRLWDPVVLAYLIPGALLLGTFMAFL
FT                   GTLSAAALAGLSSILGNLTLFGLIMMFLIIGTLRKVLVYEAFVEGAKEGFDVAKSLLPY
FT                   LVAMLCAVGVLRASGALDFGLEGIRHLVQWLGLDTRFVDALPTAMVKPFSGSAARALLI
FT                   ETMQTQGVDSFAALAAATIQGSTETTFYVLAVYFGAVGIQRARHAVGCALLAEFSGVVA
FT                   AIFVCYWFFGATAS"
     MLNGLWLGFF VVATISALVQ WLVGGNAGIF AAMVESIFAM AKLSVEVMVL LFGTLTLWLG        60
     FLRIAEKAGI VDWLAKVLGP LFLRLMPEVP PGHPALGLIT LNFAANALGL DNAATPIGLK       120
     AMRSLQELNP SKTAASNAQI LFLVLNASSL TLLPVTIFMY RAQQGAPDPT LVFLPILLAT       180
     SVSTIVGLLS VAFMQRLRLW DPVVLAYLIP GALLLGTFMA FLGTLSAAAL AGLSSILGNL       240
     TLFGLIMMFL IIGTLRKVLV YEAFVEGAKE GFDVAKSLLP YLVAMLCAVG VLRASGALDF       300
     GLEGIRHLVQ WLGLDTRFVD ALPTAMVKPF SGSAARALLI ETMQTQGVDS FAALAAATIQ       360
     GSTETTFYVL AVYFGAVGIQ RARHAVGCAL LAEFSGVVAA IFVCYWFFGA TAS              413
//

If you have problems or comments...

PBIL Back to PBIL home page