(data stored in ACNUC7421 zone)

EMBL: CP000075.PE70

CP000075.PE70        Location/Qualifiers
FT   CDS             72227..73060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35144"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35144.1"
FT                   /translation="MGMRFVALRATLHAQNRTQSVQNGIPTRSMGTMMSLSTYRSSRSS
FT                   VGLLFVTLRVITLRHATHSGPDAERPERHTHAEHGYDDVLESTYRSSRSSVGMLFVTLR
FT                   VITLRHATHSGPDAERPERHTHAEHGYDGVLESTYRSSRSSVGMLFVMLRVITLRHATH
FT                   SGPDAERPERHTHAEHGYDGVLESAYRSSHSSVGLLFVTLRVITLRHATHSGSDAERPE
FT                   RHTHAEHGYDGVLESRYRSPTQSVGAIIVRPSAAINGTGQPRDAVLSPGHSAPGR"
     MGMRFVALRA TLHAQNRTQS VQNGIPTRSM GTMMSLSTYR SSRSSVGLLF VTLRVITLRH        60
     ATHSGPDAER PERHTHAEHG YDDVLESTYR SSRSSVGMLF VTLRVITLRH ATHSGPDAER       120
     PERHTHAEHG YDGVLESTYR SSRSSVGMLF VMLRVITLRH ATHSGPDAER PERHTHAEHG       180
     YDGVLESAYR SSHSSVGLLF VTLRVITLRH ATHSGSDAER PERHTHAEHG YDGVLESRYR       240
     SPTQSVGAII VRPSAAINGT GQPRDAVLSP GHSAPGR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page