(data stored in ACNUC7421 zone)

EMBL: CP000075.PE73

CP000075.PE73        Location/Qualifiers
FT   CDS             76238..77620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0073"
FT                   /product="Multi antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35147"
FT                   /db_xref="GOA:Q500M5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q500M5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35147.1"
FT                   /translation="MQHSALKELWIILRLAGPLIASQMAHMLMVFTDTVMMGKIGPEAL
FT                   AGGGLGAATYSFVSFFCVGVMAAVGTLVSIRHGAGDTEGATRLTQAGLWLAWGMALVAA
FT                   LLLWNLEPILLQFGQAEANVHMAAQFLITLPFALPGLLSFMALRGFTSALGRAGPVMTI
FT                   SLAGAAANFVLNYALIHQWLGLPNLGLMGIGLVTAIVTNCMALALALHIRLHPAYAAYP
FT                   IRKGLSKLSRSHLGELWRLGLPIGGTYAVEVGLFTFAAFCMGAMGSTQMAAHQIALQTV
FT                   SMAFMVPVGMSYAVTMRIGQHYGAGNLLMVRMAGRLGIGFGGCVMLMFGLLFWLAPHLV
FT                   IGLFLDINDPAFAEIVVLATKLLAIAALFEFFDGTQTIAMGAIRGLKDARTTFLIGLGC
FT                   YWLIAAPAAWLLGFSTDAGASGVWWGLALGLFCSAVALTYAFEWKTARLLRQDAAGLPV
FT                   PG"
     MQHSALKELW IILRLAGPLI ASQMAHMLMV FTDTVMMGKI GPEALAGGGL GAATYSFVSF        60
     FCVGVMAAVG TLVSIRHGAG DTEGATRLTQ AGLWLAWGMA LVAALLLWNL EPILLQFGQA       120
     EANVHMAAQF LITLPFALPG LLSFMALRGF TSALGRAGPV MTISLAGAAA NFVLNYALIH       180
     QWLGLPNLGL MGIGLVTAIV TNCMALALAL HIRLHPAYAA YPIRKGLSKL SRSHLGELWR       240
     LGLPIGGTYA VEVGLFTFAA FCMGAMGSTQ MAAHQIALQT VSMAFMVPVG MSYAVTMRIG       300
     QHYGAGNLLM VRMAGRLGIG FGGCVMLMFG LLFWLAPHLV IGLFLDINDP AFAEIVVLAT       360
     KLLAIAALFE FFDGTQTIAM GAIRGLKDAR TTFLIGLGCY WLIAAPAAWL LGFSTDAGAS       420
     GVWWGLALGL FCSAVALTYA FEWKTARLLR QDAAGLPVPG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page