(data stored in ACNUC7421 zone)

EMBL: CP000075.PE80

CP000075.PE80        Location/Qualifiers
FT   CDS             86468..87280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0080"
FT                   /product="Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35154"
FT                   /db_xref="GOA:Q500L8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35154.1"
FT                   /translation="MDEHQLLGVGLGTVIGMVLALTGAGGGILAVPLLVFGLGLSIVEA
FT                   APVGLLAVGLAAGIGAVLGLRQGIVRYRAAGYIASIGVLMAPLGLWLAHRLPNTPLALV
FT                   FSAVLLYACGRMFIRASRELRHEKPAPRAEILPCVLNPLQGRLRWTMPCLRALTLTGVG
FT                   SGLLSGLLGVGGGFVIIPALTRYSDLDMKSVVATSLAVIALVSMGSVITASLSGVMHWA
FT                   VGAPFALGAVIGLIIGRQVARYLAGPRLQQLFAVCGIVAAFMLALSVR"
     MDEHQLLGVG LGTVIGMVLA LTGAGGGILA VPLLVFGLGL SIVEAAPVGL LAVGLAAGIG        60
     AVLGLRQGIV RYRAAGYIAS IGVLMAPLGL WLAHRLPNTP LALVFSAVLL YACGRMFIRA       120
     SRELRHEKPA PRAEILPCVL NPLQGRLRWT MPCLRALTLT GVGSGLLSGL LGVGGGFVII       180
     PALTRYSDLD MKSVVATSLA VIALVSMGSV ITASLSGVMH WAVGAPFALG AVIGLIIGRQ       240
     VARYLAGPRL QQLFAVCGIV AAFMLALSVR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page