(data stored in ACNUC7421 zone)

EMBL: CP000075.PE82

CP000075.PE82        Location/Qualifiers
FT   CDS             complement(88464..89336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0082"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35156"
FT                   /db_xref="GOA:Q500L6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35156.1"
FT                   /translation="MSYSSVSAAASANAARRGSAVSRRILIGLCWLVFVLFLGLPLFIV
FT                   VSQGLKNGLGAFFIAILEPDALSALKLTVIAVLISVPLNLVFGVSAAWCVSKYSFRGKS
FT                   ILVTLIDLPFSVSPVIAGLVYVLMFGAQGLFGPWLQDHDIQIVFALPGIVLATIFVTVP
FT                   FVARELIPLMQEQGTQEEEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEF
FT                   GAVSVVSGHIRGVTNTLPLHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSESRIN
FT                   RLRHNAAEE"
     MSYSSVSAAA SANAARRGSA VSRRILIGLC WLVFVLFLGL PLFIVVSQGL KNGLGAFFIA        60
     ILEPDALSAL KLTVIAVLIS VPLNLVFGVS AAWCVSKYSF RGKSILVTLI DLPFSVSPVI       120
     AGLVYVLMFG AQGLFGPWLQ DHDIQIVFAL PGIVLATIFV TVPFVARELI PLMQEQGTQE       180
     EEAARLLGAN GWQMFWHVTV PNIKWGLIYG VVLCTARAMG EFGAVSVVSG HIRGVTNTLP       240
     LHVEILYNEY NHVAAFAVAS LLLILALFIL LLKQWSESRI NRLRHNAAEE                  290
//

If you have problems or comments...

PBIL Back to PBIL home page