(data stored in SCRATCH zone)

EMBL: CP000075.PE83

CP000075.PE83        Location/Qualifiers
FT   CDS             complement(89350..90171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0083"
FT                   /product="Binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35157"
FT                   /db_xref="GOA:Q500L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35157.1"
FT                   /translation="MSRRISPVIPGFGLTLGYTLVYLSLIVLIPLAAMFVHAAQLTWDQ
FT                   FWTIITAPRVIAALKLSFGTAFYAALINGVIGTLLAWVLVRYTFPGRKVIDAMIDLPFA
FT                   LPTAVAGIALTALYAPNGWVGQFAADLGFKIAYTPLGITLALTFVTLPFVVRTVQPVLA
FT                   DIPREVEEAAACLGARPLQVFRHILVPALLPAWLTGFALAFARGVGEYGSVIFIAGNMP
FT                   MKTEILPLLIMVKLDQYDYTGATAIGVMMLVVSFILLLLINLLQRRIETPS"
     MSRRISPVIP GFGLTLGYTL VYLSLIVLIP LAAMFVHAAQ LTWDQFWTII TAPRVIAALK        60
     LSFGTAFYAA LINGVIGTLL AWVLVRYTFP GRKVIDAMID LPFALPTAVA GIALTALYAP       120
     NGWVGQFAAD LGFKIAYTPL GITLALTFVT LPFVVRTVQP VLADIPREVE EAAACLGARP       180
     LQVFRHILVP ALLPAWLTGF ALAFARGVGE YGSVIFIAGN MPMKTEILPL LIMVKLDQYD       240
     YTGATAIGVM MLVVSFILLL LINLLQRRIE TPS                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page