(data stored in ACNUC7421 zone)

EMBL: CP000075.PE84

CP000075.PE84        Location/Qualifiers
FT   CDS             complement(90266..91276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0084"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35158"
FT                   /db_xref="GOA:Q500L4"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q500L4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35158.1"
FT                   /translation="MSIRRFALAALASAVFAGSAVAKDYELLNVSYDPTRELYQDYNAE
FT                   FVNFWKKSHPDDKVEIKQSHGGSGKQARGVIDGLRADVVTLALAGDIDEIARLGKTLPE
FT                   NWQTRLPDASTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVSVITPNPKTSGGARWNFLA
FT                   AWAYGLKAGGGDEAKAKEYVQTLFKHVPILDTGARGSTITFVNNGQGDVLLAWENEAFL
FT                   ALKEDGGKDKFDIVVPSLSILAEPPVAVVDKNAERKGNSEIATEYLKHLYSKEGQEIAA
FT                   KNFYRPRDAEVAAKYEKQFPKLDLVTIDKDFGGWKTAQPKFFNDGGVFDQIYQAQ"
     MSIRRFALAA LASAVFAGSA VAKDYELLNV SYDPTRELYQ DYNAEFVNFW KKSHPDDKVE        60
     IKQSHGGSGK QARGVIDGLR ADVVTLALAG DIDEIARLGK TLPENWQTRL PDASTPYTST       120
     IVFLVRKGNP KGIKDWGDLT KEGVSVITPN PKTSGGARWN FLAAWAYGLK AGGGDEAKAK       180
     EYVQTLFKHV PILDTGARGS TITFVNNGQG DVLLAWENEA FLALKEDGGK DKFDIVVPSL       240
     SILAEPPVAV VDKNAERKGN SEIATEYLKH LYSKEGQEIA AKNFYRPRDA EVAAKYEKQF       300
     PKLDLVTIDK DFGGWKTAQP KFFNDGGVFD QIYQAQ                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page