(data stored in SCRATCH zone)

EMBL: CP000075.PE94

CP000075.PE94        Location/Qualifiers
FT   CDS             103896..104600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35168"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35168.1"
FT                   /translation="MPEARLVRAFFVFGFSNSQDMLASIIREQSVDAQEHELRDKYNEL
FT                   KRRFDSRKHNADLLDKQINRREPLIISHSLMAGYIEAMSNWKADEQELNEKRQSHSTRL
FT                   EQIKQQVVEDMAKARQAGTGAATAYAQAVAWGDTEGEKTANADAQKAAKSLATAAEHNR
FT                   RQGLIISVLEQELITVDRYVAEAQEKHKGIERNALWLSQTVRKRNGTRPLRHSSMWAEG
FT                   YGRITTFSALIK"
     MPEARLVRAF FVFGFSNSQD MLASIIREQS VDAQEHELRD KYNELKRRFD SRKHNADLLD        60
     KQINRREPLI ISHSLMAGYI EAMSNWKADE QELNEKRQSH STRLEQIKQQ VVEDMAKARQ       120
     AGTGAATAYA QAVAWGDTEG EKTANADAQK AAKSLATAAE HNRRQGLIIS VLEQELITVD       180
     RYVAEAQEKH KGIERNALWL SQTVRKRNGT RPLRHSSMWA EGYGRITTFS ALIK             234
//

If you have problems or comments...

PBIL Back to PBIL home page