(data stored in ACNUC7421 zone)

EMBL: CP000075.PE97

CP000075.PE97        Location/Qualifiers
FT   CDS             108211..109452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35171"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35171.1"
FT                   /translation="MSEENGYMEGFHDPIRHLKYLRQSLSQDNESIGFFLSAGCPLSVN
FT                   MPTDEWPLIPDVANLTKFINSQLVENVQYKTLLAELVKAERNSENIEDTLSFLRSLLTV
FT                   SKGGDVRGLSEANLLDLEKKICKIIVKKIDVLLPSQDTPYHQLCKWIRSIDRKTPVEIF
FT                   TTNYDLLMEQSLEDLEVEYFDGFVGARRSFFDLRALEDNLIPVHWSRLWKIHGSINWYK
FT                   EEVSGQKKVYRSSEIKEDASHLIYPSHLKYEESRKMPYLALIDQLNRFIRKKSSLLIMS
FT                   GYSFNDGHLNDTIINALKANPTAMVLALMYGNFEDQLPDGLAKEKYPEAYRLAKNQHNL
FT                   NIWTFNKAIIGTNPGRWSIFPENDDTDLDIRTFITSIKIDDTSGKTENIIKLGDFAVFT
FT                   SFLKRIIGSASGAN"
     MSEENGYMEG FHDPIRHLKY LRQSLSQDNE SIGFFLSAGC PLSVNMPTDE WPLIPDVANL        60
     TKFINSQLVE NVQYKTLLAE LVKAERNSEN IEDTLSFLRS LLTVSKGGDV RGLSEANLLD       120
     LEKKICKIIV KKIDVLLPSQ DTPYHQLCKW IRSIDRKTPV EIFTTNYDLL MEQSLEDLEV       180
     EYFDGFVGAR RSFFDLRALE DNLIPVHWSR LWKIHGSINW YKEEVSGQKK VYRSSEIKED       240
     ASHLIYPSHL KYEESRKMPY LALIDQLNRF IRKKSSLLIM SGYSFNDGHL NDTIINALKA       300
     NPTAMVLALM YGNFEDQLPD GLAKEKYPEA YRLAKNQHNL NIWTFNKAII GTNPGRWSIF       360
     PENDDTDLDI RTFITSIKID DTSGKTENII KLGDFAVFTS FLKRIIGSAS GAN              413
//

If you have problems or comments...

PBIL Back to PBIL home page