(data stored in ACNUC7421 zone)

EMBL: CP000075.PE98

CP000075.PE98        Location/Qualifiers
FT   CDS             109452..111323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Psyr_0098"
FT                   /product="Protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Psyr_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAY35172"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q500K0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAY35172.1"
FT                   /translation="MASKETYLGDVQDVNGTAVSISLSKQSLTGFIYIDGQGYRVGQIG
FT                   SFVRIPIGFSDLFGIVSQVGASAVPENKNIIKDQSNRWMRIQLVGEGQRNGSFQRGLSQ
FT                   YPTIGDEVHLVSEKELKTIYGRPDRPYFVKLGHISNAESIPALIDINKLVTRHSAIVGT
FT                   TGSGKSTTVASIMNALSDTEKYPSSRIIMLDLHGEYGSALKDKADIFKINSFKLSKLAE
FT                   SELQIPFWALNFDELCEISFGEFSNEKEKNVVMERVHKLKAESIAKYPRTGASLDSVSV
FT                   DSPIPFSIHHLWYDLFIETFATYYKGRPGKPMDNLAFELDPAGNELRGNPAAGIPPIFK
FT                   NIVTEANEEKINYLPGSLNIGKNVLLLGTKLRIPRYDFIFRPGDWMPEADGSVVTDLDK
FT                   LLESWIGRKSISILDLSGVPPDILQTTIGAVLRILYEALFWARNLSQGGRHRPLLIVME
FT                   EAHIYLNDSFKGMASKIVQRIVKEGRKYGIGAMIVSQRPSEIDPTILSQCGTFFALRLT
FT                   NSTDRAHITSALSDNLDGLTSMLPILRTGEAIILGEAVKLPMRTSILAPPKNRRPDSQD
FT                   PIVYDEFPFDESLSPGGWGIKMEGSPNYEELVETWRAQNPRIDKIKP"
     MASKETYLGD VQDVNGTAVS ISLSKQSLTG FIYIDGQGYR VGQIGSFVRI PIGFSDLFGI        60
     VSQVGASAVP ENKNIIKDQS NRWMRIQLVG EGQRNGSFQR GLSQYPTIGD EVHLVSEKEL       120
     KTIYGRPDRP YFVKLGHISN AESIPALIDI NKLVTRHSAI VGTTGSGKST TVASIMNALS       180
     DTEKYPSSRI IMLDLHGEYG SALKDKADIF KINSFKLSKL AESELQIPFW ALNFDELCEI       240
     SFGEFSNEKE KNVVMERVHK LKAESIAKYP RTGASLDSVS VDSPIPFSIH HLWYDLFIET       300
     FATYYKGRPG KPMDNLAFEL DPAGNELRGN PAAGIPPIFK NIVTEANEEK INYLPGSLNI       360
     GKNVLLLGTK LRIPRYDFIF RPGDWMPEAD GSVVTDLDKL LESWIGRKSI SILDLSGVPP       420
     DILQTTIGAV LRILYEALFW ARNLSQGGRH RPLLIVMEEA HIYLNDSFKG MASKIVQRIV       480
     KEGRKYGIGA MIVSQRPSEI DPTILSQCGT FFALRLTNST DRAHITSALS DNLDGLTSML       540
     PILRTGEAII LGEAVKLPMR TSILAPPKNR RPDSQDPIVY DEFPFDESLS PGGWGIKMEG       600
     SPNYEELVET WRAQNPRIDK IKP                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page