(data stored in ACNUC7421 zone)

EMBL: CP000088.PE1

CP000088.PE1         Location/Qualifiers
FT   CDS             195..2042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0001"
FT                   /product="bacterial chromosomal replication initiator
FT                   protein, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54041"
FT                   /db_xref="GOA:Q47U23"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47U23"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54041.1"
FT                   /translation="MSEGQINLAMVWSRVLDNLDNNSLPPQHRAWLPQTRPLGLIEDTA
FT                   LLAAPNEFAKEILETRLRTVISQALSAELGREIRVAVTVDPSAVPPSAPTEEASSTSSP
FT                   DSSHPAPDQGSASYSGPRDTARQQAWSQQPVLPDPQPTAPQFTPSGRPGPLPGEPFSRG
FT                   PDLLSSGWNPSSADPGSPASPAPVAESDTGPRYQSWDTSAPHWDQPNRWETPRPWEGGP
FT                   HPGAGNRPHDVGGDSGVPSAEQPPVTPPLGVTERGDGSTNPTSGGPDQLNPKYTFDTFV
FT                   IGSSNRFAHAAAVAVAEAPAKAYNPLFVYGGSGLGKTHLLHAIGHYTQRLYEGARVRYV
FT                   SSEEFTNEFINSIRDGKADGFRRRYRDIDVLLVDDIQFLENKEQTQEEFFHTFNTLHNS
FT                   NKQIVISSDRPPKQLVTLEDRLRNRFEWGLITDVQPPELETRIAILRKKAAQEGLNAPP
FT                   EVLEFIASKISTNIRELEGALIRVTAFASLNRQSVDLHLTSIVLRDLIPNDEVPEITAA
FT                   EIMAQTASYFGLTPEDLCGTSRSRVLVTARQIAMYLCRELTDLSLPKIGQQFGRDHTTV
FT                   MHADRKIRSLMAERRSIYNQVTELTNRIKQQAHHNHHHL"
     MSEGQINLAM VWSRVLDNLD NNSLPPQHRA WLPQTRPLGL IEDTALLAAP NEFAKEILET        60
     RLRTVISQAL SAELGREIRV AVTVDPSAVP PSAPTEEASS TSSPDSSHPA PDQGSASYSG       120
     PRDTARQQAW SQQPVLPDPQ PTAPQFTPSG RPGPLPGEPF SRGPDLLSSG WNPSSADPGS       180
     PASPAPVAES DTGPRYQSWD TSAPHWDQPN RWETPRPWEG GPHPGAGNRP HDVGGDSGVP       240
     SAEQPPVTPP LGVTERGDGS TNPTSGGPDQ LNPKYTFDTF VIGSSNRFAH AAAVAVAEAP       300
     AKAYNPLFVY GGSGLGKTHL LHAIGHYTQR LYEGARVRYV SSEEFTNEFI NSIRDGKADG       360
     FRRRYRDIDV LLVDDIQFLE NKEQTQEEFF HTFNTLHNSN KQIVISSDRP PKQLVTLEDR       420
     LRNRFEWGLI TDVQPPELET RIAILRKKAA QEGLNAPPEV LEFIASKIST NIRELEGALI       480
     RVTAFASLNR QSVDLHLTSI VLRDLIPNDE VPEITAAEIM AQTASYFGLT PEDLCGTSRS       540
     RVLVTARQIA MYLCRELTDL SLPKIGQQFG RDHTTVMHAD RKIRSLMAER RSIYNQVTEL       600
     TNRIKQQAHH NHHHL                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page