(data stored in ACNUC7421 zone)

EMBL: CP000088.PE119

CP000088.PE119       Location/Qualifiers
FT   CDS             complement(144426..144971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54159"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54159.1"
FT                   /translation="MAVVQLTISALPAHVRTARLMATAVARRAGVSESTLDEIRLAVGE
FT                   ACSRAVEAHRTHCPDQPIKLELIDSSGPTGPGGPSGPDRINGSRSGRFEVVVSDHAPAK
FT                   ENGAPAFNGFEGGPHASLGESLTSGGFGGLSPDVGLAVIRGLADEVSIEPSENGTVIRM
FT                   SWPLASNEADISEAHGLD"
     MAVVQLTISA LPAHVRTARL MATAVARRAG VSESTLDEIR LAVGEACSRA VEAHRTHCPD        60
     QPIKLELIDS SGPTGPGGPS GPDRINGSRS GRFEVVVSDH APAKENGAPA FNGFEGGPHA       120
     SLGESLTSGG FGGLSPDVGL AVIRGLADEV SIEPSENGTV IRMSWPLASN EADISEAHGL       180
     D                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page