(data stored in ACNUC7421 zone)

EMBL: CP000088.PE122

CP000088.PE122       Location/Qualifiers
FT   CDS             complement(148193..148636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54162"
FT                   /db_xref="GOA:Q47TQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TQ2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54162.1"
FT                   /translation="MRRPPTARPTAPARQGTSALFRDRGAVTAETAVVLPGLALLLGVA
FT                   LCCVHAAAAHVACVDAARVGARALARGDDEAVVRSLVAQAGPPEATAELSMAEGFARVE
FT                   VTAPVRIIPGLPPTVRVSGTAAIPAEPEVDALAVRSADAPSSP"
     MRRPPTARPT APARQGTSAL FRDRGAVTAE TAVVLPGLAL LLGVALCCVH AAAAHVACVD        60
     AARVGARALA RGDDEAVVRS LVAQAGPPEA TAELSMAEGF ARVEVTAPVR IIPGLPPTVR       120
     VSGTAAIPAE PEVDALAVRS ADAPSSP                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page