(data stored in ACNUC7421 zone)

EMBL: CP000088.PE127

CP000088.PE127       Location/Qualifiers
FT   CDS             complement(151683..152777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0129"
FT                   /product="putative septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54167"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54167.1"
FT                   /translation="MPSTSSARPLFLTDDPALLDDLLRLAAAANVDVTVVSSAARSSRY
FT                   WAQAPLVVVGTDLVGVLARAEPPRHAHAVVVSRTPLSPALDFSVYPDAMRIGARDVLVL
FT                   PDAEQQLVALLTESTDHAGEEALVVSVIGGRGGAGASLLAAALALAGHRAGLRTALVDA
FT                   DPLGGGLDILLGAEHVPGSRWEEFSNRQGRMLWPALRDSLPHIHGLPVVTWTRHGPYAP
FT                   IPPQAMRTVLHAATRGCQMLVVDLPRALDAAAEEVLRRTTVALMILPAEVSAVVAAERL
FT                   LPALRDSVADLRLVVRGATPDILSAESVASSLKLPLAGDLPDDTELPRLLDQGELPTRR
FT                   TRSPLVAFSEAFVAHLCPERVRSA"
     MPSTSSARPL FLTDDPALLD DLLRLAAAAN VDVTVVSSAA RSSRYWAQAP LVVVGTDLVG        60
     VLARAEPPRH AHAVVVSRTP LSPALDFSVY PDAMRIGARD VLVLPDAEQQ LVALLTESTD       120
     HAGEEALVVS VIGGRGGAGA SLLAAALALA GHRAGLRTAL VDADPLGGGL DILLGAEHVP       180
     GSRWEEFSNR QGRMLWPALR DSLPHIHGLP VVTWTRHGPY APIPPQAMRT VLHAATRGCQ       240
     MLVVDLPRAL DAAAEEVLRR TTVALMILPA EVSAVVAAER LLPALRDSVA DLRLVVRGAT       300
     PDILSAESVA SSLKLPLAGD LPDDTELPRL LDQGELPTRR TRSPLVAFSE AFVAHLCPER       360
     VRSA                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page