(data stored in ACNUC7421 zone)

EMBL: CP000088.PE128

CP000088.PE128       Location/Qualifiers
FT   CDS             complement(153502..154314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54168"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54168.1"
FT                   /translation="MNAVPTDPLMRIAEIPEVARAVDETRSLVDMLIGQRVLRRRGSDV
FT                   SMEAALRGARASAVLEGADVSLEQVRFGESDDPRVRGSVRVSGELGLLVETWSKAPRQV
FT                   LARLHVLAASDVVAPEALGRPRRDGDDVTDPLELGSPPPASEVIARLEALTSLLTARTE
FT                   APAVVVGAIVHGELLALRPFGWGDGIVARAAERLTLMARGLDPNSLVPTQLGHEQRREH
FT                   YAAALRGYMTGTPEGVAGWVVHCAQAVMEGARDSLATCEAIRRATTRR"
     MNAVPTDPLM RIAEIPEVAR AVDETRSLVD MLIGQRVLRR RGSDVSMEAA LRGARASAVL        60
     EGADVSLEQV RFGESDDPRV RGSVRVSGEL GLLVETWSKA PRQVLARLHV LAASDVVAPE       120
     ALGRPRRDGD DVTDPLELGS PPPASEVIAR LEALTSLLTA RTEAPAVVVG AIVHGELLAL       180
     RPFGWGDGIV ARAAERLTLM ARGLDPNSLV PTQLGHEQRR EHYAAALRGY MTGTPEGVAG       240
     WVVHCAQAVM EGARDSLATC EAIRRATTRR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page