(data stored in ACNUC7421 zone)

EMBL: CP000088.PE129

CP000088.PE129       Location/Qualifiers
FT   CDS             154466..154927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54169"
FT                   /db_xref="GOA:Q47TP5"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54169.1"
FT                   /translation="MCPMEGAAAVSKTNTGGRKPVDVDAPRRSLGELTSEVTGHLSHLV
FT                   SLQLELARTELAADVRRVVQGTALVITAALVAHLILILASMTIAFALIAFGLPGWLAFL
FT                   IVTLVYTLVAVILGIVGVRSYKKIRGMPRSKETFDKTKAVLRREHTAQQ"
     MCPMEGAAAV SKTNTGGRKP VDVDAPRRSL GELTSEVTGH LSHLVSLQLE LARTELAADV        60
     RRVVQGTALV ITAALVAHLI LILASMTIAF ALIAFGLPGW LAFLIVTLVY TLVAVILGIV       120
     GVRSYKKIRG MPRSKETFDK TKAVLRREHT AQQ                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page