(data stored in ACNUC7421 zone)

EMBL: CP000088.PE13

CP000088.PE13        Location/Qualifiers
FT   CDS             complement(18230..18988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0013"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54053"
FT                   /db_xref="GOA:Q47U11"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U11"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54053.1"
FT                   /translation="MMGFSHATTGVLVGVAVAAPLAAAAGTPPTPMGLLAWALLGAGSA
FT                   LVPDLDHPSSTATRSQGFVTGLLSRGMRALSLAVYRRTRTPADRSDGEHRHLGHTPVFA
FT                   AAVGAVIGLLCHLSWWATLVTAWFLAFLGLRALRKVAWRGLRTALGSWPGAALGALCVA
FT                   ALFLTAWDNYPPGWIVGAVVALGMIVHSLGDALTSSGVPLAWPFTVNGRRWAMLGVPRW
FT                   MRFRTGTWPEWVVGAVSLTGSLAVGYALVA"
     MMGFSHATTG VLVGVAVAAP LAAAAGTPPT PMGLLAWALL GAGSALVPDL DHPSSTATRS        60
     QGFVTGLLSR GMRALSLAVY RRTRTPADRS DGEHRHLGHT PVFAAAVGAV IGLLCHLSWW       120
     ATLVTAWFLA FLGLRALRKV AWRGLRTALG SWPGAALGAL CVAALFLTAW DNYPPGWIVG       180
     AVVALGMIVH SLGDALTSSG VPLAWPFTVN GRRWAMLGVP RWMRFRTGTW PEWVVGAVSL       240
     TGSLAVGYAL VA                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page