(data stored in ACNUC7421 zone)

EMBL: CP000088.PE133

CP000088.PE133       Location/Qualifiers
FT   CDS             159489..159962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54173"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54173.1"
FT                   /translation="MSRRLVVLRHAQAEHSASLADVDRPLTQEGRQQARMVGERLAREG
FT                   LLPDHVLCSTARRTRQTWDLVAEQLPCEPEVDFDAELYTADVDTALQLVSYVDPQVRTL
FT                   LVVGHNPTMAQLAAAFDSESGYLSFPPASVAVVDLDVDWLYIAPGTGRLRLVM"
     MSRRLVVLRH AQAEHSASLA DVDRPLTQEG RQQARMVGER LAREGLLPDH VLCSTARRTR        60
     QTWDLVAEQL PCEPEVDFDA ELYTADVDTA LQLVSYVDPQ VRTLLVVGHN PTMAQLAAAF       120
     DSESGYLSFP PASVAVVDLD VDWLYIAPGT GRLRLVM                                157
//

If you have problems or comments...

PBIL Back to PBIL home page