(data stored in ACNUC7421 zone)

EMBL: CP000088.PE136

CP000088.PE136       Location/Qualifiers
FT   CDS             complement(162022..162642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54176"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54176.1"
FT                   /translation="MGNAANHSHALPPERRRASDADRDRVAQLLGEAFVDGRLTAEEHA
FT                   ERLDALSTATTLGDLQPLIADLGPAPTLSEAEELRASSTGAENIVAVFGSAKRSGRWLV
FT                   EPRTNTSTLFGEIALDLREAVLSQREVVIQCGLVFGSLKLTVPPGVRIVNETTPIFGDV
FT                   DLKKTDSAVTVNAPTIRLRGSVMFSSVKVRTRTLGKRKLPWMR"
     MGNAANHSHA LPPERRRASD ADRDRVAQLL GEAFVDGRLT AEEHAERLDA LSTATTLGDL        60
     QPLIADLGPA PTLSEAEELR ASSTGAENIV AVFGSAKRSG RWLVEPRTNT STLFGEIALD       120
     LREAVLSQRE VVIQCGLVFG SLKLTVPPGV RIVNETTPIF GDVDLKKTDS AVTVNAPTIR       180
     LRGSVMFSSV KVRTRTLGKR KLPWMR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page