(data stored in ACNUC7421 zone)

EMBL: CP000088.PE137

CP000088.PE137       Location/Qualifiers
FT   CDS             163057..163842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0139"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54177"
FT                   /db_xref="GOA:Q47TN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54177.1"
FT                   /translation="MNGHVLHMSGVGVRRGQTVLLDAVDWTVAEGERWVVVGPNGAGKT
FT                   TLLRIAATQLHPTRGTVEVLGERLGRGDVFELRPMIGFASSAVAAQLEDDMRVRDVVVS
FT                   AAYGYLGTGKEEYSAPDYARARALLGRWGVLRFEDRAFGTLSEGERKRVLIARALMSNP
FT                   ELLLLDEPAAGLDLGAREDLVRRLGTLAKDESAPALVLVTHHVEEIPPGFTHGLLLRGG
FT                   KVVAAGPLEQVMTADHLSTTFGIGLKVEFDGERWSARAS"
     MNGHVLHMSG VGVRRGQTVL LDAVDWTVAE GERWVVVGPN GAGKTTLLRI AATQLHPTRG        60
     TVEVLGERLG RGDVFELRPM IGFASSAVAA QLEDDMRVRD VVVSAAYGYL GTGKEEYSAP       120
     DYARARALLG RWGVLRFEDR AFGTLSEGER KRVLIARALM SNPELLLLDE PAAGLDLGAR       180
     EDLVRRLGTL AKDESAPALV LVTHHVEEIP PGFTHGLLLR GGKVVAAGPL EQVMTADHLS       240
     TTFGIGLKVE FDGERWSARA S                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page