(data stored in ACNUC7421 zone)

EMBL: CP000088.PE140

CP000088.PE140       Location/Qualifiers
FT   CDS             complement(165620..166504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54180"
FT                   /db_xref="GOA:Q47TN4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54180.1"
FT                   /translation="MREELAVVADSTLSRTLTGIAAGVPYLAIPPSDPAPTVPIVVALH
FT                   AFEPPRSEAALAGTLPLLGLPAWRFYLGLPLFGHRLPKGGVSEVNRLGREDYLLQLYSP
FT                   VVRQAAAELPLAVAELRRSFSLADAPLGLMGVGAGGAAVFLALIESDLPVGAVGVVNPV
FT                   IDPTHVLSARERHLGVDYTWDDQSRDAAAGLDFTERANELASRGPDTPVLIVNGEHDEI
FT                   IRPSHGRLLHDALSPHHQPHTLRHVVIPDLAHTLGPEPGLDPGPPTPGTVLTDRALTEW
FT                   FHTHLIARPQAAP"
     MREELAVVAD STLSRTLTGI AAGVPYLAIP PSDPAPTVPI VVALHAFEPP RSEAALAGTL        60
     PLLGLPAWRF YLGLPLFGHR LPKGGVSEVN RLGREDYLLQ LYSPVVRQAA AELPLAVAEL       120
     RRSFSLADAP LGLMGVGAGG AAVFLALIES DLPVGAVGVV NPVIDPTHVL SARERHLGVD       180
     YTWDDQSRDA AAGLDFTERA NELASRGPDT PVLIVNGEHD EIIRPSHGRL LHDALSPHHQ       240
     PHTLRHVVIP DLAHTLGPEP GLDPGPPTPG TVLTDRALTE WFHTHLIARP QAAP             294
//

If you have problems or comments...

PBIL Back to PBIL home page