(data stored in ACNUC7421 zone)

EMBL: CP000088.PE142

CP000088.PE142       Location/Qualifiers
FT   CDS             complement(168164..169300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54182"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54182.1"
FT                   /translation="MTPFSSLTLPNGRPLRFGALLATALLATACGTASDELSNDSSDRP
FT                   AQPTPSASAEPVKEPYTVAIGGDVMFEGMLRQRLDADPATAMGPVAEVFQEADVSVVNL
FT                   ETAVTDGGTPAPAKQFVFRAPATAFTALKEAGIDVATVANNHGMDYGTEGLLDTLENAE
FT                   AADFPIIGAGRDIAEAYEPEFFEVKGNTLAIIGATDVLDDHLIPEWTAGEGKPGLASTK
FT                   GEMITHAIDAVEKASAEADAVIVFLHWGLEGDHCPLPHAPDLAKQLIDAGATAVVGGHA
FT                   HVVSPGGYMGSSYVHYGLGNFVFYNFNGPTAETGVLRLTLQGGEILEDEWLPGRIEGGV
FT                   PILFEDEQAIAEGVARFEGYREQCSGINLTAEPGEPAV"
     MTPFSSLTLP NGRPLRFGAL LATALLATAC GTASDELSND SSDRPAQPTP SASAEPVKEP        60
     YTVAIGGDVM FEGMLRQRLD ADPATAMGPV AEVFQEADVS VVNLETAVTD GGTPAPAKQF       120
     VFRAPATAFT ALKEAGIDVA TVANNHGMDY GTEGLLDTLE NAEAADFPII GAGRDIAEAY       180
     EPEFFEVKGN TLAIIGATDV LDDHLIPEWT AGEGKPGLAS TKGEMITHAI DAVEKASAEA       240
     DAVIVFLHWG LEGDHCPLPH APDLAKQLID AGATAVVGGH AHVVSPGGYM GSSYVHYGLG       300
     NFVFYNFNGP TAETGVLRLT LQGGEILEDE WLPGRIEGGV PILFEDEQAI AEGVARFEGY       360
     REQCSGINLT AEPGEPAV                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page