(data stored in ACNUC7421 zone)

EMBL: CP000088.PE144

CP000088.PE144       Location/Qualifiers
FT   CDS             170878..171678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0146"
FT                   /product="Surface protein from Gram-positive cocci, anchor
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54184"
FT                   /db_xref="GOA:Q47TN0"
FT                   /db_xref="InterPro:IPR005528"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54184.1"
FT                   /translation="MRKTTFASAAVLAAGLAVGFASPASADQAVSGNQIIIPVDVALDV
FT                   CGNTVAVLGDAQGACQSFVDALKSASGGAVTLQSNQGGGLANGNQIVIPVNVALNVCGN
FT                   TITALGEAKGTCDTIVEALEDAADDVVNSSDVPSDGSGGGLLNDNKIAVPIDADVDVCG
FT                   NAVSVLGSAESDCPEEDTAAPNKPAEPEQPGGGSEQPKPDEGGEKPAADDKPAEDAKPA
FT                   PAAEDTLPVTGAALGGLVAAAVAALGGGGAAMYFTRRKRNASEN"
     MRKTTFASAA VLAAGLAVGF ASPASADQAV SGNQIIIPVD VALDVCGNTV AVLGDAQGAC        60
     QSFVDALKSA SGGAVTLQSN QGGGLANGNQ IVIPVNVALN VCGNTITALG EAKGTCDTIV       120
     EALEDAADDV VNSSDVPSDG SGGGLLNDNK IAVPIDADVD VCGNAVSVLG SAESDCPEED       180
     TAAPNKPAEP EQPGGGSEQP KPDEGGEKPA ADDKPAEDAK PAPAAEDTLP VTGAALGGLV       240
     AAAVAALGGG GAAMYFTRRK RNASEN                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page