(data stored in ACNUC7421 zone)

EMBL: CP000088.PE161

CP000088.PE161       Location/Qualifiers
FT   CDS             complement(187692..189401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0163"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54201"
FT                   /db_xref="GOA:Q47TL3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54201.1"
FT                   /translation="MTSPLRPEDPTRVGDYDLVARIGKGGQGVVYLGKAPDGTRVAVKV
FT                   METSWASNSRARSRFAKEIEAASKVAPFCTAALLDSDINADPPYIVSEYIEGPSLRDAV
FT                   LRDGPRTGAALDRLAISTATALVAIHQAGVIHRDFKPANVLLGPDGPRVIDFGIARHSE
FT                   ATVTATDSIVGTPAYMAPEQVEGRELTPAVDIFAWAGVMVFAATGQSPFHDETLPAIIN
FT                   RVLHQPPRLDGVDERLRPLLEACLAKEPERRPTAVQVLGVLVGHDPATLPQVPVEEVLE
FT                   NGYTAALNEQTQIAATAALPIPIGDQAPEPAPTAVMPAAEDTPAPESRTPVSGLAALAA
FT                   NRPADEAPASSPPSGPLRTTSGLAALVNTGENKQPTASSPGEGPPRRSAGPGHQPLPPR
FT                   STRERKTVLSWLVAAGILIIVLAGGWFLIDTFLLSPNGQSPEATPVDGTRRDTPAQDGI
FT                   DDSVPSPSAIDPDTPTSSDTGYPGGELYPSLPYDDMSQTDPMEEPHLNPTIPGEGPWHS
FT                   PPAGEEAPGQPHGGGAEEGGSEGGEQPGTGGPGGSGEGGAGVGRVAVSPAAP"
     MTSPLRPEDP TRVGDYDLVA RIGKGGQGVV YLGKAPDGTR VAVKVMETSW ASNSRARSRF        60
     AKEIEAASKV APFCTAALLD SDINADPPYI VSEYIEGPSL RDAVLRDGPR TGAALDRLAI       120
     STATALVAIH QAGVIHRDFK PANVLLGPDG PRVIDFGIAR HSEATVTATD SIVGTPAYMA       180
     PEQVEGRELT PAVDIFAWAG VMVFAATGQS PFHDETLPAI INRVLHQPPR LDGVDERLRP       240
     LLEACLAKEP ERRPTAVQVL GVLVGHDPAT LPQVPVEEVL ENGYTAALNE QTQIAATAAL       300
     PIPIGDQAPE PAPTAVMPAA EDTPAPESRT PVSGLAALAA NRPADEAPAS SPPSGPLRTT       360
     SGLAALVNTG ENKQPTASSP GEGPPRRSAG PGHQPLPPRS TRERKTVLSW LVAAGILIIV       420
     LAGGWFLIDT FLLSPNGQSP EATPVDGTRR DTPAQDGIDD SVPSPSAIDP DTPTSSDTGY       480
     PGGELYPSLP YDDMSQTDPM EEPHLNPTIP GEGPWHSPPA GEEAPGQPHG GGAEEGGSEG       540
     GEQPGTGGPG GSGEGGAGVG RVAVSPAAP                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page