(data stored in ACNUC7421 zone)

EMBL: CP000088.PE162

CP000088.PE162       Location/Qualifiers
FT   CDS             190024..190854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54202"
FT                   /db_xref="GOA:Q47TL2"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54202.1"
FT                   /translation="MRVPLLLRPRWLGIHLLALLAVLTCTLFGYWQYERAQRPDRETVT
FT                   NPVADLAAAVDISTLLRPGEYMPQDLANEAVVVTGTYDAEHQLLSPALSPDGAEGYSVV
FT                   IPLVTEDGVAVAVNRGWIPLDAADEVPPPPDGEVTVRGWLQLPQDEASRGYSAILPEGQ
FT                   IARISSALLVNEWPYQLYEGYVTLGEQSPPTPAGAGSALEEFPPPDPPQGIVWNFRNLS
FT                   YAAQWWVFGLAAIVFWVSLMRRELDDHRKARQDGGAAAEGPAEPAQPSAEMVAD"
     MRVPLLLRPR WLGIHLLALL AVLTCTLFGY WQYERAQRPD RETVTNPVAD LAAAVDISTL        60
     LRPGEYMPQD LANEAVVVTG TYDAEHQLLS PALSPDGAEG YSVVIPLVTE DGVAVAVNRG       120
     WIPLDAADEV PPPPDGEVTV RGWLQLPQDE ASRGYSAILP EGQIARISSA LLVNEWPYQL       180
     YEGYVTLGEQ SPPTPAGAGS ALEEFPPPDP PQGIVWNFRN LSYAAQWWVF GLAAIVFWVS       240
     LMRRELDDHR KARQDGGAAA EGPAEPAQPS AEMVAD                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page